1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-13
  5. IL-13 Protein, Human

IL-13 Protein, Human

Cat. No.: HY-P72795
COA Handling Instructions

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human is the recombinant human-derived IL-13 protein, expressed by E. coli , with tag free. The total length of IL-13 Protein, Human is 112 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $120 In-stock
10 μg $195 In-stock
50 μg $556 In-stock
100 μg $900 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human is the recombinant human-derived IL-13 protein, expressed by E. coli , with tag free. The total length of IL-13 Protein, Human is 112 a.a..

Background

Interleukin-13 (IL-13) is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. IL-13 synergizes with IL2 in regulating interferon-gamma synthesis. IL-13 exerts its biological effects through the IL4R chain and the IL13RA1 chain, to activate JAK1, TYK2 and STAT6. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. In human macrophages and monocytes, hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1][2][3][4][5][6].

Biological Activity

The cell proliferation assay using human TF-1 cells has an ED50 value of less than 5 ng/mL.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.195 ng/mL, corresponding to a specific activity is 8.37×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P35225 (G35-N146)

Gene ID
Molecular Construction
N-term
IL-13 (G35-N146)
Accession # P35225
C-term
Synonyms
Interleukin-13; IL-13
AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Weight

Approximately 12.3 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.2, with 5-8% trehalose.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-13 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13 Protein, Human
Cat. No.:
HY-P72795
Quantity:
MCE Japan Authorized Agent: