IL-13 Protein, Human

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human is the recombinant human-derived IL-13 protein, expressed by E. coli , with tag free. The total length of IL-13 Protein, Human is 112 a.a., with molecular weight of ~12.3 kDa.

Interleukin-13 (IL-13) is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. IL-13 synergizes with IL2 in regulating interferon-gamma synthesis. IL-13 exerts its biological effects through the IL4R chain and the IL13RA1 chain, to activate JAK1, TYK2 and STAT6. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. In human macrophages and monocytes, hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent^{[1][2][3][4][5][6]}.

The cell proliferation assay using human TF-1 cells has an ED₅₀ value of less than 0.5 ng/mL, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.

Human

E. coli

Tag Free

P35225 (G35-N146)

3596  [NCBI]

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Approximately 12.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.2, with 5% trehalose.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.