IL-13 Protein, Human

Cat. No.: HY-P72795: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Stock	Quantity
Free Sample	Apply now
5 μg	In-stock	Estimated Time of Arrival: December 31
10 μg	In-stock	Estimated Time of Arrival: December 31
50 μg	In-stock	Estimated Time of Arrival: December 31
100 μg	In-stock	Estimated Time of Arrival: December 31
> 100 μg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

16 Publications Citing Use of MCE IL-13 Protein, Human

Cell Proliferation/Viability Assay

: IL-13 Protein, Human purchased from MCE. Usage Cited in: MedComm-Oncology. 2024 Apr 24.; Maintaining IL-13 (4 ng/mL) is crucial for maintaining memory homeostasis, and drug exposure can lead to a decrease in IL-13 levels, thereby increasing the number of cellular sclerosis cells (CSCs).

: IL-13 Protein, Human purchased from MCE. Usage Cited in: MedComm-Oncology. 2024 Apr 24.; IL-13 and long-term potentiation (LTP) using semi-quantitative PCR analysis. IL-13-mediated LTP desensitizes drug effect and enhances stemness markers (CD95 and CD58) and memory marker (GRIN2B) (+(w1 h) indicates that cells were replaced with fresh media after 1 h of incubation with IL-13 (4 ng/mL) and +(1 h) indicates 3BPA addition post 1h treatment initiation with IL-13).

: IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]; BEAS-2B cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in BEAS-2B cells was detected by Western blotting.

: IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]; HBSMC cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in HBSMC cells was detected by Western blotting.

: IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]; HBSMC cells were transfected with either control siRNA or ATG5 siRNA and then treated with IL-13 (10 ng/mL) for 24 hours. Cells treated with IL-13 were then treated with 20 µM Ang-(1–7) for 24 hours, with PBS treatment serving as a control. Cell viability was assessed using the CCK-8 assay kit.

Biological Activity
Technical Parameters
Properties
Documentation
References

Description	IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.
Background	IL-13 belongs to the interleukin (IL) family^[1]. IL-13 is a multifunctional cytokine^[1]^[2]^[5]. IL-13 binds to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface, activates the JAK-STAT6 signaling pathway, and regulates gene expression. Its effects are cell type specific (e.g., dependent on the γc chain in hematopoietic cells and dependent on IL-13Rα1 in non-hematopoietic cells)^[1]^[5]. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 can promote airway eosinophil infiltration, AHR, and liver fibrosis in mice^[1]^[3]^[5]. IL-13 is expressed in a variety of tissues and cells, including immune cells (such as macrophages, monocytes, B cells) and structural cells (such as fibroblasts, airway smooth muscle cells) in the lung, liver, esophagus, etc^[1]^[3]^[5]. IL-13, Human has approximately 60% homology with mouse IL-13 in amino acid sequence, but there are species differences in function (such as human IL-13 does not activate mouse IL-13 receptor)^[5]. IL-13, Human is a non-glycosylated protein composed of 132 amino acids with a molecular weight of approximately 10 kDa^[4].
In Vitro	IL-13 Protein, Human (0.8 nM) induces eotaxin-1 production in normal human lung fibroblasts (NHLF)^[5].
In Vivo	IL-13 Protein, Human (2 μg) induces inflammation in the mouse air pouch model, resulting in infiltration of leukocytes and eosinophils^[5].
Biological Activity	The cell proliferation assay using human TF-1 cells has an ED₅₀ value of less than 5 ng/mL. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1.195 ng/mL, corresponding to a specific activity is 8.37×10⁵ U/mg.
Species	Human
Source	E. coli
Tag	Tag Free
Accession	P35225 (G35-N146)
Gene ID	3596 [NCBI]
Molecular Construction	N-term IL-13 (G35-N146) Accession # P35225 C-term
Protein Length	Partial
Synonyms	Interleukin-13; IL-13
AA Sequence	GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Predicted Molecular Mass	12.3 kDa
Molecular Weight	Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
Purity	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 5% trehalose. 2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 8% trehalose. Please refer to the lot-specific COA for specific buffer information.
Endotoxin Level	<1 EU/μg; determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (264 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)
References	[1]. Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205(11):2595-608. [Content Brief] [2]. Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181(7):4656-65. [Content Brief] [3]. Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354). Clin Exp Allergy. 2005 Aug;35(8):1096-103. [Content Brief] [4]. de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151(11):6370-81. [Content Brief] [5]. May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166(1):177-93. [Content Brief]