Copy Link Print Information

IL-13 Protein, Human

17 Cited Publications
Customer Review

Based on 17 publication(s) in Google Scholar

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • IL-13 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

Background

IL-13 belongs to the interleukin (IL) family[1]. IL-13 is a multifunctional cytokine[1][2][5]. IL-13 binds to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface, activates the JAK-STAT6 signaling pathway, and regulates gene expression. Its effects are cell type specific (e.g., dependent on the γc chain in hematopoietic cells and dependent on IL-13Rα1 in non-hematopoietic cells)[1][5]. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 can promote airway eosinophil infiltration, AHR, and liver fibrosis in mice[1][3][5]. IL-13 is expressed in a variety of tissues and cells, including immune cells (such as macrophages, monocytes, B cells) and structural cells (such as fibroblasts, airway smooth muscle cells) in the lung, liver, esophagus, etc[1][3][5]. IL-13, Human has approximately 60% homology with mouse IL-13 in amino acid sequence, but there are species differences in function (such as human IL-13 does not activate mouse IL-13 receptor)[5]. IL-13, Human is a non-glycosylated protein composed of 132 amino acids with a molecular weight of approximately 10 kDa[4].

In Vitro

IL-13 Protein, Human (0.8 nM) induces eotaxin-1 production in normal human lung fibroblasts (NHLF)[5].

In Vivo

IL-13 Protein, Human (2 μg) induces inflammation in the mouse air pouch model, resulting in infiltration of leukocytes and eosinophils[5].

Verified Bioactivity

The cell proliferation assay using human TF-1 cells has an ED50 value of less than 5 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P35225 (G35-N146)

  • Gene ID
    3596  [NCBI]
  • Molecular Construction
    • N-term
    • IL-13 (G35-N146, Q144R)
      Accession # P35225
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

  • Predicted Molecular Mass

    12.3 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205(11):2595-608. [Content Brief]

[2]. Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181(7):4656-65. [Content Brief]

[3]. Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354). Clin Exp Allergy. 2005 Aug;35(8):1096-103. [Content Brief]

[4]. de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151(11):6370-81. [Content Brief]

[5]. May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166(1):177-93. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.195 ng/mL, corresponding to a specific activity is 8.37×105 U/mg.

  • 1/16

    IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    Customer Validation
     Maintaining IL-13 (4 ng/mL) is crucial for maintaining memory homeostasis, and drug exposure can lead to a decrease in IL-13 levels, thereby increasing the number of cellular sclerosis cells (CSCs).

  • 1/16

    IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    Customer Validation
     IL-13 and long-term potentiation (LTP) using semi-quantitative PCR analysis. IL-13-mediated LTP desensitizes drug effect and enhances stemness markers (CD95 and CD58) and memory marker (GRIN2B) (+(w1 h) indicates that cells were replaced with fresh media after 1 h of incubation with IL-13 (4 ng/mL) and +(1 h) indicates 3BPA addition post 1h treatment initiation with IL-13).

  • 1/16

    IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    Customer Validation
     BEAS-2B cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in BEAS-2B cells was detected by Western blotting.

  • 1/16

    IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    Customer Validation
     HBSMC cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in HBSMC cells was detected by Western blotting.

  • 1/16

    IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    Customer Validation
     HBSMC cells were transfected with either control siRNA or ATG5 siRNA and then treated with IL-13 (10 ng/mL) for 24 hours. Cells treated with IL-13 were then treated with 20 µM Ang-(1–7) for 24 hours, with PBS treatment serving as a control. Cell viability was assessed using the CCK-8 assay kit.

  • IL-13 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • Experimental Validation Results for IL-13 Protein, Human
  • IL-13 Protein, Human Product Image

  • IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    Maintaining IL-13 (4 ng/mL) is crucial for maintaining memory homeostasis, and drug exposure can lead to a decrease in IL-13 levels, thereby increasing the number of cellular sclerosis cells (CSCs).

  • IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    IL-13 and long-term potentiation (LTP) using semi-quantitative PCR analysis. IL-13-mediated LTP desensitizes drug effect and enhances stemness markers (CD95 and CD58) and memory marker (GRIN2B) (+(w1 h) indicates that cells were replaced with fresh media after 1 h of incubation with IL-13 (4 ng/mL) and +(1 h) indicates 3BPA addition post 1h treatment initiation with IL-13).

  • IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    BEAS-2B cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in BEAS-2B cells was detected by Western blotting.

  • IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    HBSMC cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in HBSMC cells was detected by Western blotting.

  • IL-13 Protein, Human purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422. [Abstract]

    HBSMC cells were transfected with either control siRNA or ATG5 siRNA and then treated with IL-13 (10 ng/mL) for 24 hours. Cells treated with IL-13 were then treated with 20 µM Ang-(1–7) for 24 hours, with PBS treatment serving as a control. Cell viability was assessed using the CCK-8 assay kit.