IL-15 Protein, Rhesus macaque (P.pastoris, His)
Based on 1 Customer Validation
The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived IL-15 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Rhesus Macaque
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived IL-15 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
The IL-15 Protein, a cytokine, plays a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites by modulating immune cells within both the innate and adaptive immune systems. Its influence extends to stimulating the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. IL-15 exerts its effects in monocytes by inducing the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Notably, IL-15 differs from most cytokines in that it is expressed in association with its high-affinity receptor IL15RA on the surface of IL15-producing cells. This unique expression pattern allows IL-15 to deliver signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.
Verified Bioactivity
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 2.330-2.534 ng/mL, corresponding to a specific activity is ≥3.946×105 units/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rhesus Macaque
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P48092 (N49-S162)
-
Molecular Construction
-
N-term
-
6*His
-
IL-15 (N49-S162)
Accession # P48092 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15
-
AA Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)