1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-15
  5. IL-15 Protein, Rhesus macaque (P.pastoris, His)

IL-15 Protein, Rhesus macaque (P.pastoris, His)

Cat. No.: HY-P71745
COA Handling Instructions

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived IL-15 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of IL-15 Protein, Rhesus macaque (P.pastoris, His) is 114 a.a., with molecular weight of ~16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $145 In-stock
10 μg $245 In-stock
50 μg $680 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived IL-15 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of IL-15 Protein, Rhesus macaque (P.pastoris, His) is 114 a.a., with molecular weight of ~16 kDa.

Background

The IL-15 Protein, a cytokine, plays a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites by modulating immune cells within both the innate and adaptive immune systems. Its influence extends to stimulating the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. IL-15 exerts its effects in monocytes by inducing the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Notably, IL-15 differs from most cytokines in that it is expressed in association with its high-affinity receptor IL15RA on the surface of IL15-producing cells. This unique expression pattern allows IL-15 to deliver signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

Species

Rhesus Macaque

Source

P. pastoris

Tag

N-6*His

Accession

P48092 (N49-S162)

Gene ID
Molecular Construction
N-term
6*His
IL-15 (N49-S162)
Accession # P48092
C-term
Synonyms
IL15; Interleukin-15; IL-15
AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Weight

Approximately 16 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-15 Protein, Rhesus macaque (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-15 Protein, Rhesus macaque (P.pastoris, His)
Cat. No.:
HY-P71745
Quantity:
MCE Japan Authorized Agent: