IL-17B Protein, Human (HEK293, Fc)

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis^[1][2]. IL-17B Protein, Human (HEK293, Fc) is a recombinant human IL-17B protein with hFc tag at the C-terminus and is expressed in HEK293 cells. It consists of 160 amino acids (Q21-F180).

Interleukin-17B (IL-17B) belongs to the IL-17 cytokine family and is a proinflammatory cytokine. IL-17B is expressed in adult pancreas, small intestine, stomach, spinal cord and testis^[1].
The human IL-17B shares 88.33% amino acid sequence identity with mouse.
IL-17B is secreted as a non-covalent dimer glycoprotein. IL-17B shares about 27% amino acid identity with IL-17A and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β in the THP-1 monocytic cell line. The receptor of IL-17B is IL-17RB, which belongs to the IL-17 receptor family. IL-17B shares IL-17RB with IL-17E. IL-17B inhibits IL-17E binding to IL-17RA/IL-17RB complexes, exhibits protumor roles and IL-17E antitumor activities^[1][2].
IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis^[1].

rhIL17B (0-100 ng/mL; 90 min) negatively impacts on HECV cell-matrix adhesion and migration^[1].
rhIL17B (0-250 ng/mL; 4-5 h) can reduce HECV tubule formation^[1].
rhIL17B (250ng/mL) reduces HECV tubule formation and reduces the capacity of HECV cells to migrate in a scratch wounding assay, and significant differences in migrated distance were observed following 75 minute incubation^[3].
Pre-treatment with rhIL17B (10 ng/mL; 72 h) significantly decreased paclitaxel-induced cytotoxicity in BT20 and MDA-MB-468 cells and also in MCF7 cells, while it had not effect on the IL-17RB negative MDA-MB-435S cell line^[4].

rhIL-17B (0.1-10 μg/mouse; i.p.; once) elicits neutrophil migration in BALB/c mice^[5].

Human

HEK293

C-hFc

Q9UHF5 (Q21-F180)

27190  [NCBI]

QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Approximately 48 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Sanders AJ, et al. IL-17B Can Impact on Endothelial Cellular Traits Linked to Tumour Angiogenesis. J Oncol. 2010;2010:817375.  [Content Brief]

  [2]. Bastid J, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.  [Content Brief]

  [3]. Sanders A, et al. Impact of IL17B on Endothelial Cells and Angiogenesis. Cancer Research, 2009, 69(24_Supplement): 2157-2157.

  [4]. Laprevotte E, et al. The IL-17B-IL-17 receptor B pathway promotes resistance to paclitaxel in breast tumors through activation of the ERK1/2 pathway. Oncotarget. 2017 Dec 6;8(69):113360-113372.  [Content Brief]

  [5]. Shi Y, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275(25):19167-76.  [Content Brief]