IL-17B Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis. IL-17B Protein, Human (HEK293, Fc) is a recombinant human IL-17B protein with hFc tag at the C-terminus and is expressed in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1][2]. IL-17B Protein, Human (HEK293, Fc) is a recombinant human IL-17B protein with hFc tag at the C-terminus and is expressed in HEK293 cells.
Background
Interleukin-17B (IL-17B) belongs to the IL-17 cytokine family and is a proinflammatory cytokine. IL-17B is expressed in adult pancreas, small intestine, stomach, spinal cord and testis[1].
The human IL-17B shares 88.33% amino acid sequence identity with mouse.
IL-17B is secreted as a non-covalent dimer glycoprotein. IL-17B shares about 27% amino acid identity with IL-17A and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β in the THP-1 monocytic cell line. The receptor of IL-17B is IL-17RB, which belongs to the IL-17 receptor family. IL-17B shares IL-17RB with IL-17E. IL-17B inhibits IL-17E binding to IL-17RA/IL-17RB complexes, exhibits protumor roles and IL-17E antitumor activities[1][2].
IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1].
In Vitro
rhIL17B (0-100 ng/mL; 90 min) negatively impacts on HECV cell-matrix adhesion and migration[1].
rhIL17B (0-250 ng/mL; 4-5 h) can reduce HECV tubule formation[1].
rhIL17B (250ng/mL) reduces HECV tubule formation and reduces the capacity of HECV cells to migrate in a scratch wounding assay, and significant differences in migrated distance were observed following 75 minute incubation[3].
Pre-treatment with rhIL17B (10 ng/mL; 72 h) significantly decreased paclitaxel-induced cytotoxicity in BT20 and MDA-MB-468 cells and also in MCF7 cells, while it had not effect on the IL-17RB negative MDA-MB-435S cell line[4].
In Vivo
rhIL-17B (0.1-10 μg/mouse; i.p.; once) elicits neutrophil migration in BALB/c mice[5].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9UHF5 (Q21-F180)
-
Molecular Construction
-
N-term
-
IL-17B (Q21-F180)
Accession # Q9UHF5 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL17B; MGC138901; Interleukin 17B; Neuronal Interleukin-17 Related Factor; IL-17B; Cytokine-Like Protein ZCYTO7; ZCYTO7; Interleukin-17 Beta; IL-20; Cytokine Zcyto7; NIRF; Interleukin 20; Neuronal Interleukin-17-Related Factor; Interleukin-20; Interleukin
-
AA Sequence
QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
-
Predicted Molecular Mass
45.1 kDa
-
Molecular Weight
Approximately 48-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sanders AJ, et al. IL-17B Can Impact on Endothelial Cellular Traits Linked to Tumour Angiogenesis. J Oncol. 2010;2010:817375. [Content Brief]
[2]. Bastid J, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718. [Content Brief]
[4]. Laprevotte E, et al. The IL-17B-IL-17 receptor B pathway promotes resistance to paclitaxel in breast tumors through activation of the ERK1/2 pathway. Oncotarget. 2017 Dec 6;8(69):113360-113372. [Content Brief]
[5]. Shi Y, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275(25):19167-76. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
