1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors Epithelial cell CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. IL-1R IL-1R1/CD121a
  5. IL-1R1 Protein, Rat (HEK293, His)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB, MAPK pathways . IL-1R1 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-1R1 (M1-K352) with a C terminal His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB, MAPK pathways [1]. IL-1R1 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-1R1 (M1-K352) with a C terminal His tag, which is produced in HEK293 cells.

Background

IL-1R1 (CD121a), a member of IL-1 receptor, is a receptor for IL-1α, IL-1β, IL-1Ra and IL-38, thereby mediating IL-1-dependent activation[1]. IL-1R1 is mainly expressed in endothelial cells and astrocytes. The neuronal distribution of IL-1R1 is limited in the rat forebrain, and is expressed in the hippocampus, basolateral amygdala and ARH. [2].
The sequence of amino acids in IL-1R1 differs in different species. Rats IL-1R1 shares 85.59% aa sequence identity with mouse, and shares <70% aa sequence identity with Human IL-1R1.
IL-1R1 interacts with IL-1α and IL-1β, thereby promoting signal transduction together with IL-1R3 (IL-1RAcP)[3]. IL-1R1 is important in necrosome formation. IL-1R1 interacts with p-MLKL to trigger neuronal necroptosis after tGCI (global cerebral ischemia)[4].
IL-1R1 mediates necrosome formation, and immune and inflammatory responses including the activation of NF-κB, MAPK and other pathways.

In Vitro

IL-1R1 (murine, .5 μg/mL) prevents the loss of cell-surface IL-1R1 in Il1rn−/− blood cells[6].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat IL-1R1 at 10 μg/ml (100 μl/well) can bind Human IL-1RN. The ED50 for this effect is 2.163 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat IL-1R1 at 10 μg/mL (100 μL/well) can bind Human IL-1RN. The ED50 for this effect is 2.163 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_037255.3 (L34-K352)

Gene ID
Molecular Construction
N-term
IL-1R1 (L34-K352)
Accession # NP_037255.3
His
C-term
Protein Length

Partial

Synonyms
Interleukin-1 receptor type 1; IL-1R-1; CD121a; IL1R1; IL1R; IL1RA; IL1RT1
AA Sequence

LETDKCTEYPNEVISFSSVNEIDIRSCPLTPNEMHGGTIIWYKNDSKTPISADKDSRIHQQNEHLWFVPAKMEDSGYYYCIMRNSTYCLKTKITMSVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPKVQWYKNCKPLPLDDGNFFGFKNKLMVMNVAEEHRGNYTCRTSYTYQGKQYPVTRVITFITIDDSKRDRPVIMSPRNETMEADPGSTIQLICNVTGQFTDLVYWKWNGSEIEWDDPILAEDYQFLEHPSAKRKYTLITTLNVSEVKSQFYRYPFICFVKNTHILETAHVRLVYPVPDFK

Molecular Weight

52-75 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-1R1 Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1R1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74822
Quantity:
MCE Japan Authorized Agent: