IL-1RA/IL-1RN Protein, Rat (C-His)

The IL-1RA/IL-1RN mutant protein, an enhanced anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Engineered for increased inhibitory capabilities, this mutant variant critically safeguards the host from immune dysregulation and prevents uncontrolled systemic inflammation triggered by IL1 in response to innate stimulatory agents. Offering optimized defense against IL1-mediated inflammation, the mutant protein significantly contributes to maintaining immune balance and preventing excessive inflammation. IL-1RA/IL-1RN Protein, Rat (C-His) is the recombinant rat-derived IL-1RA/IL-1RN protein, expressed by E. coli, with C-6*His labeled tag. The total length of IL-1RA/IL-1RN Protein, Rat (C-His) is 152 a.a., with molecular weight of ~19.94 kDa.

The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.

Measured by its ability to inhibit proliferation in CTLL‑2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED₅₀ for this effect is 84.78 ng/mL, corresponding to a specific activity is 1.180×10⁴ units/mg.

• 
  Measured by its ability to inhibit proliferation in CTLL‑2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED₅₀ for this effect is 84.78 ng/mL, corresponding to a specific activity is 1.180×10⁴ units/mg.

Rat

E. coli

C-6*His

P25086 (H27-Q178)

60582  [NCBI]

HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ

Approximately 19.94 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.