1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-2 Receptor IL-2R beta/CD122
  5. IL-2R beta/CD122 Protein, Rat (HEK293, His)

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately). IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells. IL-2R beta/CD122 Protein, Rat (HEK293, His) is a recombinant rat IL-2R beta (M1-E239) with a C-Terminal His tag, which is produced in HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Rat (HEK293, His) is a recombinant rat IL-2R beta (M1-E239) with a C-Terminal His tag, which is produced in HEK293 cells.

Background

IL-2R beta (CD122) is a type I cytokine receptor, and belongs to Type 4 subfamily. IL-2R beta is also a key component of the IL-15 receptor. IL-2R beta is broadly expressed in spleen, blood, and lymph node, such as B and T lymphocytes[1][3].
The sequence of amino acids in IL-2R beta differs in different species. Rats IL-2R beta shares 81.01% aa sequence identity with mouse. Human IL-2R beta shares <60% aa sequence identity with mouse and rats.
IL-2R beta cytoplasmic domain heterodimerizes with IL-2 and leads to the activation of signaling pathways: phosphoinositol 3-kinase (PI3-K)/AKT, Ras-MAP kinase, and the JAK-STAT pathways[4]. IL-2R beta binds IL-2 with intermediate affinity. IL-2R beta mediates IL-2 internalization and signal transduction, such as cell proliferation or differentiation[5]. IL-2R beta interacts with IL-2 and increases the proportion of CD4+ T lymphocytes[1]. IL-2R stimulates T cell proliferation and activating lymphokine-activated killer cells[2].
IL-2R beta mediates T cell immune responses, and also mediates endocytosis, as well as transducing the mitogenic signals of IL-2.

Biological Activity

Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 7.957 µg/mL in the presence of 4.0 ng/mL of recombinant human IL-15, corresponding to a specific activity is 6.094×105 units/mg.

  • Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 7.957 µg/mL in the presence of 4.0 ng/mL of recombinant human IL-15, corresponding to a specific activity is 6.094×105 units/mg.
Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_037327 (A27-E239)

Gene ID
Molecular Construction
N-term
IL-2Rβ (A27-E239)
Accession # NP_037327
His
C-term
Protein Length

Partial

Synonyms
Interleukin-2 receptor subunit beta; IL2RB; High affinity IL-2 receptor subunit beta; CD122
AA Sequence

AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCNFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPVAFRTRPADPKE

분자량

Approximately 30-49 kDa.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-2R beta/CD122 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-2R beta/CD122 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76771
수량:
MCE Japan Authorized Agent: