IL-2R gamma/CD132 Protein, Rat (HEK293, His)

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells ^[1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types^[3]. IL-2R gamma/CD132 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-2R beta (M1-A262) with a C-Terminal His tag, which is produced in HEK293 cells.

IL-2R gamma (CD132), a receptor for IL-2, is a member of the type I cytokine receptor family and type 5 subfamily. IL-2R gamma is expressed in spleen and thymus^[1].
The sequence of amino acids in IL-2R beta differs in different species. Rats IL-2R gamma shares 80.70% aa sequence identity with mice. Rats IL-2R gamma shares <75% aa sequence identity with human.
IL-2R gamma has low-affinity for IL-2, but has intermediate affinity for IL-2 when forming heterodimer with IL-2R beta. IL-2R beta/gama heterodimer complex transduces a signal when IL-2 concentrations are relatively high^[2]. IL-2R gamma can be utilized by the IL-2, IL-4, IL-7, IL-9, and IL-15 receptor, and takes part in the development, activation, proliferation, differentiation and regulation of lymphocytes^[3]. IL-2R gamma also affects the development of NK and B cells in rats^[4].
IL-2R gamma is involved in inflammatory response, and mediates activation of the cells^[1].

IL-2R gamma binds to IL-2 in recombinant IL-2R gamma plasmid (pGEX-4T-1-IL-2Rγ)-transfected 293T cells^[5].

Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED ₅₀ for this effect is 0.8594 µg/mL, corresponding to a specific activity is 1163.603 units/mg in the presence of 5 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2.

Rat

HEK293

C-6*His

Q68FU6 (S25-A262)

140924  [NCBI]

SKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPSLFALEA

41-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. X Cao, et al. Characterization of cDNAs encoding the murine interleukin 2 receptor (IL-2R) gamma chain: chromosomal mapping and tissue specificity of IL-2R gamma chain expression. Proc Natl Acad Sci U S A. 1993 Sep 15;90(18):8464-10.  [Content Brief]

  [2]. S Hodge, et al. Surface and intracellular interleukin-2 receptor expression on various resting and activated populations involved in cell-mediated immunity in human peripheral blood. Scand J Immunol. 2000 Jan;51(1):67-74.  [Content Brief]

  [3]. W P Weidanz, et al. Signalling through the IL-2 receptor γ(c) peptide (CD134) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria.  [Content Brief]

  [4]. Xinglong Yang, et al. An Immune System-Modified Rat Model for Human Stem Cell Transplantation Research. Stem Cell Reports. 2018 Aug 14;11(2):514-521.  [Content Brief]

  [5]. Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus). Fish Shellfish Immunol. 2022 Mar;122:426-436.  [Content Brief]