1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Rat (sf9, His)

IL-3 Protein, Rat (sf9, His)

Cat. No.: HY-P73208
COA Handling Instructions

IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation. It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation. IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway. In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress. IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag. The total length of IL-3 Protein, Rat (sf9, His) is 143 a.a., with molecular weight of ~24 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation. It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation. IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway. In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress. IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag. The total length of IL-3 Protein, Rat (sf9, His) is 143 a.a., with molecular weight of ~24 kDa.

Background

IL-3, a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, assumes a pivotal role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Its influence extends to the stimulation of mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond hematopoiesis, IL-3 plays a significant role in neural cell proliferation and survival. Moreover, it contributes to bone homeostasis by inhibiting osteoclast differentiation, achieved through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal-transducing IL3RB subunit. Receptor stimulation results in the rapid activation of JAK2 kinase activity, leading to a STAT5-mediated transcriptional program. Alternatively, in non-hematopoietic systems, IL-3 contributes to cell survival under oxidative stress by activating pathways mediated by PI3K/AKT and ERK.

Biological Activity

Measured in a cell proliferation assay using FDC-P1 cells and the ED50 is typically 2-8 ng/mL.

Species

Rat

Source

Sf9 insect cells

Tag

C-6*His

Accession

P97688 (I27-C169)

Gene ID
Molecular Construction
N-term
IL-3 (I27-C169)
Accession # P97688
6*His
C-term
Synonyms
Interleukin-3; IL-3; MCGF
AA Sequence

MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.0, 10% Glycerol. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-3 Protein, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Rat (sf9, His)
Cat. No.:
HY-P73208
Quantity:
MCE Japan Authorized Agent: