IL-3 Protein, Rat (sf9, His)

IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation.It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation.IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway.In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress.IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag.

IL-3, a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, assumes a pivotal role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Its influence extends to the stimulation of mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond hematopoiesis, IL-3 plays a significant role in neural cell proliferation and survival. Moreover, it contributes to bone homeostasis by inhibiting osteoclast differentiation, achieved through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal-transducing IL3RB subunit. Receptor stimulation results in the rapid activation of JAK2 kinase activity, leading to a STAT5-mediated transcriptional program. Alternatively, in non-hematopoietic systems, IL-3 contributes to cell survival under oxidative stress by activating pathways mediated by PI3K/AKT and ERK.

Measured in a cell proliferation assay using FDC-P1 cells and the ED₅₀ is typically 2-8 ng/mL.

Rat

Sf9 insect cells

C-6*His

P97688 (I27-C169)

24495  [NCBI]

Full Length of Mature Protein

MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.