IL-3 Protein, Rat (sf9, His)
Based on 1 Customer Validation
IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation.It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation.IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway.In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress.IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation.It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation.IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway.In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress.IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag.
Background
IL-3, a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, assumes a pivotal role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Its influence extends to the stimulation of mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond hematopoiesis, IL-3 plays a significant role in neural cell proliferation and survival. Moreover, it contributes to bone homeostasis by inhibiting osteoclast differentiation, achieved through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal-transducing IL3RB subunit. Receptor stimulation results in the rapid activation of JAK2 kinase activity, leading to a STAT5-mediated transcriptional program. Alternatively, in non-hematopoietic systems, IL-3 contributes to cell survival under oxidative stress by activating pathways mediated by PI3K/AKT and ERK.
Verified Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells and the ED50 is typically 2-8 ng/mL.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-6*His
-
Accession
P97688 (I27-C169)
-
Molecular Construction
-
N-term
-
IL-3 (I27-C169)
Accession # P97688 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I
-
AA Sequence
ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
