IL-36 alpha/IL-1F6 Protein, Mouse (153a.a)

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases^[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP^[2]. IL-36 alpha/IL-1F6 Protein, Mouse (153a.a) is a recombinant mouse IL-36 alpha (R8-H160) without any tag, which is produced in E. coli.

IL-36 alpha, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha is expressed in monocytes, T/B-lymphocytes, spleen, bone-marrow tonsils, lymph nodes and skin^[2]. The sequence of amino acids in IL-36 alpha differs in different species. Human IL-36 alpha shares <55% aa sequence identity with mouse.
IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, thereby mediating inflammatory response. But the activation requires N-terminal cleavage by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3^[1]. IL-36 alpha can also bind IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP^[2]. IL-36α is significantly increased after infection. IL-36 alpha plays a key role in regulating antibacterial function of macrophages, which is required for the protection against sepsis in mice^[3]. IL-36 alpha is a proinflammatory factor in the immune response of fungal keratitis, and promotes the corneal inflammation^[4
IL-36 alpha is a pro-inflammatory cytokine associated with some infectious and immune diseases. IL-36 alpha mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway^[1].

IL-36 alpha (mouse) (10 µg, intratracheal administration) induces neutrophil influx in the lungs of wild-type C57BL/6 mice and IL-1αβ^−/− mice^[5].
IL-36 alpha (mouse) (1 µg, i.p.) improves survival in sepsis mice^[3].
IL-36 alpha (mouse) (1 µg/5 µL, subconjunctival injection) aggravates the inflammatory response in mice^[4].

Mouse

E. coli

Tag Free

Q9JLA2 (R8-H160)

54448  [NCBI]

RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.  [Content Brief]

  [2]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65.  [Content Brief]

  [3]. Tao X, Song Z, Wang C, Luo H, Luo Q, Lin X, Zhang L, Yin Y, Cao J. Interleukin 36α Attenuates Sepsis by Enhancing Antibacterial Functions of Macrophages. J Infect Dis. 2017 Jan 15;215(2):321-332.  [Content Brief]

  [4]. Niu Y, et al. IL-36α Exerts Proinflammatory Effects in Aspergillus fumigatus Keratitis of Mice Through the Pathway of IL-36α/IL-36R/NF-κB. Invest Ophthalmol Vis Sci. 2021 Apr 1;62(4):16.  [Content Brief]

  [5]. Ramadas RA, et al. IL-36α exerts pro-inflammatory effects in the lungs of mice. PLoS One. 2012;7(9):e45784.  [Content Brief]