IL-36 alpha/IL-1F6 Protein, Mouse
Based on 1 Customer Validation
IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP. IL-36 alpha/IL-1F6 Protein, Mouse is a recombinant mouse IL-36 alpha without any tag, which is produced in E. coli.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36 alpha/IL-1F6 Protein, Mouse is a recombinant mouse IL-36 alpha without any tag, which is produced in E. coli.
Background
IL-36 alpha, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha is expressed in monocytes, T/B-lymphocytes, spleen, bone-marrow tonsils, lymph nodes and skin[2].
The sequence of amino acids in IL-36 alpha differs in different species. Human IL-36 alpha shares <55% aa sequence identity with mouse.
IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, thereby mediating inflammatory response. But the activation requires N-terminal cleavage by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1]. IL-36 alpha can also bind IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36α is significantly increased after infection. IL-36 alpha plays a key role in regulating antibacterial function of macrophages, which is required for the protection against sepsis in mice[3]. IL-36 alpha is a proinflammatory factor in the immune response of fungal keratitis, and promotes the corneal inflammation[4
IL-36 alpha is a pro-inflammatory cytokine associated with some infectious and immune diseases. IL-36 alpha mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[1].
In Vivo
IL-36 alpha (mouse) (10 µg, intratracheal administration) induces neutrophil influx in the lungs of wild-type C57BL/6 mice and IL-1αβ−/− mice[5].
IL-36 alpha (mouse) (1 µg, i.p.) improves survival in sepsis mice[3].
IL-36 alpha (mouse) (1 µg/5 µL, subconjunctival injection) aggravates the inflammatory response in mice[4].
Verified Bioactivity
Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is typically 17.43 ng/mL, corresponding to a specific activity is 5.737×106 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9JLA2 (R8-H160)
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL36A; Interleukin-1 Epsilon; Prev. IL1F6; FIL1 Epsilon; IL-1F6; IL-1 Epsilon; FIL1E; MGC129553; IL1(EPSILON); MGC129552; FIL1; IL-1F6 (FIL-1-Epsilon); Interleukin 1 Family, Member 6 (Epsilon); FIL1(EPSILON); Interleukin-1 Family Member 6; IL1E; Interleuk
-
AA Sequence
RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol, 0.02% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210. [Content Brief]
[2]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65. [Content Brief]
[3]. Tao X, Song Z, Wang C, Luo H, Luo Q, Lin X, Zhang L, Yin Y, Cao J. Interleukin 36α Attenuates Sepsis by Enhancing Antibacterial Functions of Macrophages. J Infect Dis. 2017 Jan 15;215(2):321-332. [Content Brief]
[4]. Niu Y, et al. IL-36α Exerts Proinflammatory Effects in Aspergillus fumigatus Keratitis of Mice Through the Pathway of IL-36α/IL-36R/NF-κB. Invest Ophthalmol Vis Sci. 2021 Apr 1;62(4):16. [Content Brief]
[5]. Ramadas RA, et al. IL-36α exerts pro-inflammatory effects in the lungs of mice. PLoS One. 2012;7(9):e45784. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
