IL-3R alpha/CD123 Protein, Mouse (HEK293, His)
IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.
Background
The IL-3R alpha/CD123 protein functions as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, governing the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, IL-3R alpha rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins such as JAK2 and PI3K. These activated proteins play a crucial role in signaling cell proliferation and differentiation. The activation of JAK2, in particular, initiates a STAT5-mediated transcriptional program. IL-3R alpha interacts with IL3 and forms a heterodimer with an alpha and a beta subunit, with the beta subunit being common to the IL3, IL5, and GM-CSF receptors. These interactions highlight the intricate molecular mechanisms through which IL-3R alpha regulates signaling pathways, contributing to the modulation of hematopoietic cell development and function.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
P26952-1 (S17-K331)
-
Molecular Construction
-
N-term
-
IL-3Rα (S17-K331)
Accession # P26952-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL3RA; IL-3R-Alpha; Interleukin 3 Receptor Subunit Alpha; IL3R; CD123; HIL-3Ra; Interleukin 3 Receptor, Alpha (Low Affinity); IL3RAY; Interleukin-3 Receptor Subunit Alpha; IL-3RA; IL-3 Receptor Subunit Alpha; IL3RX; IL-3R Subunit Alpha; IL3RY; CD123 Antig
-
AA Sequence
SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
-
Predicted Molecular Mass
35.6 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
