IL-4R alpha/CD124 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation. IL-4R alpha/CD124, Human consists of 825 amino acids (M1-S825) with a transmembrane domain (233-256 a.a) and a soluble form (1-227 a.a). Soluble IL-4R (sIL-4R) inhibits IL4-mediated cell proliferation and IL-5 up-regulation by T-cells. IL-4R alpha/CD124, Human (M26-H232) is produced in HEK293 cells with a C-Terminal His-tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation[1]. IL-4R alpha/CD124, Human consists of 825 amino acids (M1-S825) with a transmembrane domain (233-256 a.a) and a soluble form (1-227 a.a). Soluble IL-4R (sIL-4R) inhibits IL4-mediated cell proliferation and IL-5 up-regulation by T-cells[1]. IL-4R alpha/CD124, Human (M26-H232) is produced in HEK293 cells with a C-Terminal His-tag.
Background
Interleukin-4R alpha (IL-4Rα), also known as CD124 and B cell stimulatory factor (BSF) receptor, is one of the anti-inflammatory cytokines, and highly expressed in activated T-cells[1].
IL-4R alpha participates in forming two interleukin receptors in different cell types. For the type I receptor, depends on IL-4R alpha binding IL-4 to recruit IL-2R gamma chain in immune cells. IL-2R gamma is the common subunit for a variety of interleukin receptors, involved in the stimulation of neutrophil phagocytosis by IL-15. For the type II receptor, depends on IL-4R alpha binding IL-4 to recruit IL-13R alpha 1 chain. IL-13R alpha 1 is an alternat accessory protein to the common cytokine receptor gamma chain in non-immune cells[2][3].
The sequence of amino acids in IL-4R alpha proteins in human is very different from mouse (53.35%), or rat (52.82%).
IL-4 R alpha generates a soluble form by alternate splicing or proteolysis, maintaining ligand binding properties and inhibiting IL-4 bioactivity. IL-4 R alpha soluble isoform 1 can be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase[4].
IL-4 R alpha plays an important role in Th2-biased immune responses, alternative macrophage activation, mucosal immunity, allergic inflammation, tumor progression, and atherogenesis[5].
In Vitro
Interleukin-4Rα (IL-4Rα) shows promotion of Th2 cytokine and IgE response without hIL-4, and fails to expel N. brasiliensis worms in transgenic mice (hIL-4RαTg/mIL-4Rα-/-) infected with Nippostrongylus brasiliensis[8].
In Vivo
Interleukin-4Rα (IL-4Rα) contains a immunoreceptor tyrosine-based inhibitory motifs (ITIM), plays a functional role in the regulation of IL-4-induced proliferation, ablation of ITIM results in a hyperproliferative response to IL-4 stimulation in 32D/IRS-2 cells expressing mutant IL-4R α-chains (△712 and Y713F)[6].
Recombinant sIL-4R (10 ng/mL; 3 d) inhibits IL-4-mediated proliferation and IL-5 upregulation by T cells[7].
Verified Bioactivity
1.The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 5-20 ng/mL.
2. Loaded Human IL-4-Fc on Protein A Biosensor, can bind Human IL-4 RA-His with an affinity constant of 0.78 nM as determined in BLI assay.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P24394-1 (M26-H232)
-
Molecular Construction
-
N-term
-
IL-4Rα (M26-H232)
Accession # P24394-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL4R; IL4RA; Interleukin 4 Receptor; Interleukin-4 Receptor Alpha Chain; Interleukin-4 Receptor Subunit Alpha; IL-4R Subunit Alpha; CD124; IL4R Nirs Variant 1; IL-4 Receptor Subunit Alpha; CD124 Antigen; Interleukin 13 Receptor; IL-4R-Alpha; IL-4RA
-
AA Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
-
Predicted Molecular Mass
24.4 kDa
-
Molecular Weight
Approximately 35-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Keegan AD,et al. An IL-4 receptor region containing an insulin receptor motif is important for IL-4-mediated IRS-1 phosphorylation and cell growth. Cell. 1994 Mar 11;76(5):811-20. [Content Brief]
[2]. Zurawski SM, et al. The primary binding subunit of the human interleukin-4 receptor is also a component of the interleukin-13 receptor. J Biol Chem. 1995 Jun 9;270(23):13869-78. [Content Brief]
[3]. Rolling C, et al. IL4 and IL13 receptors share the gamma c chain and activate STAT6, STAT3 and STAT5 proteins in normal human B cells. FEBS Lett. 1996 Sep 9;393(1):53-6. [Content Brief]
[4]. Jung T, et al. Soluble human interleukin-4 receptor is produced by activated T cells under the control of metalloproteinases. Int Arch Allergy Immunol. 1999 May;119(1):23-30. [Content Brief]
[5]. HageT,etal.Crystalstructureoftheinterleukin-4/receptoralphachaincomplexrevealsamosaicbindinginterface.Cell.1999Apr16;97(2):271-81. [Content Brief]
[6]. Kashiwada M, et al. Immunoreceptor tyrosine-based inhibitory motif of the IL-4 receptor associates with SH2-containing phosphatases and regulates IL-4-induced proliferation. J Immunol. 2001 Dec 1;167(11):6382-7. [Content Brief]
[7]. Myburgh E, et al. Murine IL-4 is able to signal via chimeric human IL-4Ralpha/mouse gamma-chain receptor. Mol Immunol. 2008 Mar;45(5):1327-36. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)