IP-10/CRG-2/CXCL10 Protein, Human (HEK293, His-Myc)

IP-10/CRG-2/CXCL10 Protein, a pro-inflammatory cytokine, participates in diverse biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and angiostatic modulation. During viral infections, IP-10 crucially stimulates immune cell activation and migration to infected sites. Mechanistically, its binding to CXCR3 activates G protein-mediated signaling, leading to calcium production and actin reorganization. This cascade recruits Th1 lymphocytes to inflammation sites. In neurons, IP-10 responds to brain injury by activating microglia, crucial for neuronal reorganization. Existing in monomeric, dimeric, and tetrameric forms, IP-10 interacts with CXCR3 through its N-terminus. IP-10/CRG-2/CXCL10 Protein, Human (HEK293, His-Myc) is the recombinant human-derived IP-10/CRG-2/CXCL10 protein, expressed by HEK293, with N-Myc, N-6*His labeled tag. The total length of IP-10/CRG-2/CXCL10 Protein, Human (HEK293, His-Myc) is 77 a.a., with molecular weight of 12.6 kDa.

IP-10 (CXCL10), a pro-inflammatory cytokine, is implicated in a diverse array of biological processes, including chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis, and modulation of angiostatic effects. Notably, during viral infections, IP-10 plays a pivotal role by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, the binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling, leading to downstream activation of the phospholipase C-dependent pathway, an increase in intracellular calcium production, and actin reorganization. This cascade results in the recruitment of activated Th1 lymphocytes to sites of inflammation. The CXCL10/CXCR3 axis also holds significance in neurons, responding to brain injury by activating microglia—the resident macrophage population of the central nervous system—and guiding them to the lesion site, a crucial element for neuronal reorganization. IP-10 exists in monomeric, dimeric, and tetrameric forms and interacts with CXCR3, specifically through its N-terminus.

Human

HEK293

N-Myc;N-6*His

P02778 (V22-P98)

3627  [NCBI]

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

12.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.