IP-10/CXCL10 Protein, Human (HEK293, His-Myc)

The IP-10/CXCL10 protein is a pro-inflammatory cytokine involved in a variety of biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and vasostatic regulation. During viral infection, IP-10 crucially stimulates immune cell activation and migration to the site of infection. IP-10/CXCL10 Protein, Human (HEK293, His-Myc) is the recombinant human-derived IP-10/CRG-2/CXCL10 protein, expressed by HEK293 , with N-Myc, N-6*His labeled tag.

IP-10 (CXCL10), a pro-inflammatory cytokine, is implicated in a diverse array of biological processes, including chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis, and modulation of angiostatic effects. Notably, during viral infections, IP-10 plays a pivotal role by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, the binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling, leading to downstream activation of the phospholipase C-dependent pathway, an increase in intracellular calcium production, and actin reorganization. This cascade results in the recruitment of activated Th1 lymphocytes to sites of inflammation. The CXCL10/CXCR3 axis also holds significance in neurons, responding to brain injury by activating microglia—the resident macrophage population of the central nervous system—and guiding them to the lesion site, a crucial element for neuronal reorganization. IP-10 exists in monomeric, dimeric, and tetrameric forms and interacts with CXCR3, specifically through its N-terminus.

Human

HEK293

N-Myc;N-6*His

P02778 (V22-P98)

3627  [NCBI]

Full Length of Mature Protein

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.