1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. JAM-A/CD321 Immunoglobulin-like Cell Adhesion Molecules
  5. Junctional Adhesion Molecule A (JAM-A)
  6. JAM-A/CD321 Protein, Mouse (HEK293, Fc)

The JAM-A/CD321 protein is critical for the formation of epithelial tight junctions and is present at primitive cell junctions where it recruits PARD3.This association may hinder PARD3-JAM1 interaction and thus tight junction assembly.JAM-A/CD321 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAM-A/CD321 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The JAM-A/CD321 protein is critical for the formation of epithelial tight junctions and is present at primitive cell junctions where it recruits PARD3.This association may hinder PARD3-JAM1 interaction and thus tight junction assembly.JAM-A/CD321 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAM-A/CD321 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

JAM-A/CD321 protein plays a crucial role in the formation of epithelial tight junctions and is present early in primordial cell junctions, where it recruits PARD3. The association of the PARD6-PARD3 complex may hinder the interaction between PARD3 and JAM1, thereby preventing the assembly of tight junctions. Furthermore, JAM-A is involved in regulating monocyte transmigration, contributing to the integrity of the epithelial barrier. Acting as a ligand for integrin alpha-L/beta-2, it participates in the transmigration of memory T-cells and neutrophils. Additionally, JAM-A is implicated in platelet activation and interacts with the ninth PDZ domain of MPDZ. Its interaction with the first PDZ domain of PARD3 may be disrupted by the association between PARD3 and PARD6B. Furthermore, JAM-A interacts with ITGAL (via I-domain), further highlighting its multifaceted involvement in cellular processes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O88792 (K27-A242)

Gene ID
Molecular Construction
N-term
JAM-A (K27-A242)
Accession # O88792
hFc
C-term
Protein Length

Partial

Synonyms
Junctional Adhesion Molecule A; JAM-A; JAM-1; PAM-1; CD321; F11R; JCAM
AA Sequence

KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA

Predicted Molecular Mass
50.2 kDa
Molecular Weight

Approximately 57 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

JAM-A/CD321 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAM-A/CD321 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73855
Quantity:
MCE Japan Authorized Agent: