JAM-A/CD321 Protein, Rat (HEK293, Fc)

The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, Fc) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-hFc labeled tag.

The JAM-A/CD321 protein plays a crucial role in the formation of tight junctions in epithelial cells. It is involved in the early stages of cell junction development and recruits PARD3. However, the formation of the PARD6-PARD3 complex may hinder the interaction between PARD3 and JAM1, leading to the prevention of tight junction assembly. Moreover, JAM-A/CD321 is involved in regulating the transmigration of monocytes, which is essential for maintaining the integrity of the epithelial barrier. It also acts as a ligand for integrin alpha-L/beta-2, facilitating the transmigration of memory T-cells and neutrophils. Additionally, JAM-A/CD321 interacts with the ninth PDZ domain of MPDZ and the first PDZ domain of PARD3, with the association between PARD3 and PARD6B possibly disrupting this interaction. Furthermore, it interacts with ITGAL (via I-domain).

Rat

HEK293

C-hFc

Q9JHY1 (K27-G238)

116479  [NCBI]

Extracellular Domain

KGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGG

Approximately 60 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.