LOX-1/OLR1 Protein, Mouse (HEK293, His)

The LOX-1/OLR1 protein is a receptor on vascular endothelial cells that promotes the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). This process is indicative of atherosclerosis and triggers endothelial cell activation, pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

LOX-1/OLR1 serves as a crucial receptor in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to LOX-1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis. This interaction induces the activation of NF-kappa-B, contributing to intracellular reactive oxygen species production and fostering various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in atherosclerosis, LOX-1 acts as a receptor for HSP70, participating in antigen cross-presentation to naive T-cells in dendritic cells. Furthermore, it plays a pivotal role in inflammatory processes by functioning as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1 acts as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. The receptor exists as a homodimer, potentially forming hexamers composed of three homodimers, and interacts with HSP70.

Mouse

HEK293

N-8*His

Q9EQ09 (R60-I363)

108078  [NCBI]

Partial

RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

55-63 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.