1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. LOX-1
  6. LOX-1/OLR1 Protein, Mouse (HEK293, His)

The LOX-1/OLR1 protein is a receptor on vascular endothelial cells that promotes the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). This process is indicative of atherosclerosis and triggers endothelial cell activation, pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LOX-1/OLR1 protein is a receptor on vascular endothelial cells that promotes the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). This process is indicative of atherosclerosis and triggers endothelial cell activation, pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

Background

LOX-1/OLR1 serves as a crucial receptor in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to LOX-1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis. This interaction induces the activation of NF-kappa-B, contributing to intracellular reactive oxygen species production and fostering various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in atherosclerosis, LOX-1 acts as a receptor for HSP70, participating in antigen cross-presentation to naive T-cells in dendritic cells. Furthermore, it plays a pivotal role in inflammatory processes by functioning as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1 acts as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. The receptor exists as a homodimer, potentially forming hexamers composed of three homodimers, and interacts with HSP70.

Species

Mouse

Source

HEK293

Tag

N-8*His

Accession

Q9EQ09 (R60-I363)

Gene ID
Molecular Construction
N-term
8*His
LOX-1 (R60-I363)
Accession # Q9EQ09
C-term
Protein Length

Partial

Synonyms
Ox-LDL receptor 1; LOX-1; CLEC8A; LOX1; OLR1; LOXIN; SR-E1; SCARE1; SLOX1
AA Sequence

RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Molecular Weight

55-63 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LOX-1/OLR1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LOX-1/OLR1 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LOX-1/OLR1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77986
Quantity:
MCE Japan Authorized Agent: