1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MYDGF Protein, Human (His)

MYDGF Protein, Human (His)

Cat. No.: HY-P70581
COA Handling Instructions

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. MYDGF Protein, Human (His) is the recombinant human-derived MYDGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of MYDGF Protein, Human (His) is 141 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $60 In-stock
50 μg $180 In-stock
100 μg $300 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. MYDGF Protein, Human (His) is the recombinant human-derived MYDGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of MYDGF Protein, Human (His) is 141 a.a., with molecular weight of ~17.0 kDa.

Background

MYDGF Protein, a paracrine-acting protein derived from bone marrow monocytes, plays a crucial role in cardiac protection and repair following myocardial infarction (MI). Its multifaceted functions include the promotion of cardiac myocyte survival and the facilitation of adaptive angiogenesis. MYDGF stimulates endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, it inhibits cardiac myocyte apoptosis through a PI3K/AKT-dependent signaling pathway. The protein's involvement in endothelial cell proliferation and angiogenesis underscores its significance in mediating processes crucial for cardiac recovery and tissue repair, making it a potential therapeutic target for cardiovascular conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q969H8 (S33-L173)

Gene ID
Molecular Construction
N-term
6*His
MYDGF (S33-L173)
Accession # Q969H8
C-term
Synonyms
UPF0556 protein C19orf10; stromal cell-derived growth factor SF20; C19orf10; Myeloid-derived growth factor; MYDGF
AA Sequence

SEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MYDGF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MYDGF Protein, Human (His)
Cat. No.:
HY-P70581
Quantity:
MCE Japan Authorized Agent: