1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Neuregulins
  5. Neuregulin-1 (NRG1)
  6. NRG1-alpha Protein, Human (65a.a, HEK293, Fc)

NRG1-alpha Protein, Human (65a.a, HEK293, Fc)

Cat. No.: HY-P73327
Handling Instructions Technical Support

NRG1-α protein binds directly to ERBB3 and ERBB4 receptors, leading to the recruitment of ERBB1 and ERBB2 coreceptors. NRG1-alpha Protein, Human (65a.a, HEK293, Fc) is the recombinant human-derived NRG1-alpha protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NRG1-α protein binds directly to ERBB3 and ERBB4 receptors, leading to the recruitment of ERBB1 and ERBB2 coreceptors. NRG1-alpha Protein, Human (65a.a, HEK293, Fc) is the recombinant human-derived NRG1-alpha protein, expressed by HEK293 , with N-hFc labeled tag.

Background

NRG1-alpha protein acts as a direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concurrently recruiting ERBB1 and ERBB2 coreceptors, thereby inducing ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The diverse functions of its multiple isoforms encompass the induction of growth and differentiation in various cell types, including epithelial, glial, neuronal, and skeletal muscle cells. NRG1-alpha is also involved in the expression of acetylcholine receptors during neuromuscular junction formation, the stimulation of lobuloalveolar budding and milk production in the mammary gland, and the induction of differentiation in mammary tumor cells. Furthermore, it stimulates Schwann cell proliferation and plays a role in myocardial development, specifically contributing to the trabeculation of the developing heart. Isoform 10 is implicated in motor and sensory neuron development. NRG1-alpha binds to ERBB4 and ERBB3, acting as a ligand for integrins and forming a ternary complex with integrins and ERBB3, a crucial step in NRG1-ERBB signaling. It induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2, and AKT1. Additionally, NRG1-alpha participates in ligand-dependent ERBB4 endocytosis, essential for the activation of these kinases in neurons, and interacts with the LIM domain region of LIMK1. It also forms a ternary complex with ERBB3 and integrins ITGAV:ITGB3 or ITGA6:ITGB4 and interacts with NRDC and BACE1.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q02297-1 (S177-K241)

Gene ID
Molecular Construction
N-term
hFc
NRG1-alpha (S177-K241)
Accession # Q02297-1
C-term
Protein Length

Partial

Synonyms
Pro-neuregulin-1; Neuregulin-1; ARIA; HRG; NRG1; GGF; HGL; HRGA; NDF; SMDF
AA Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK

Predicted Molecular Mass
35.8 kDa
Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NRG1-alpha Protein, Human (65a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NRG1-alpha Protein, Human (65a.a, HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRG1-alpha Protein, Human (65a.a, HEK293, Fc)
Cat. No.:
HY-P73327
Quantity:
MCE Japan Authorized Agent: