Neurotrophin-4 Protein, Human
Based on 1 publication(s) in Google Scholar
NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).
Background
Neurotrophin-4 (NT-4) is a member of the well-studied family of neurotrophins that regulate the development of neuronal networks by participating in the growth of neuronal processes, synaptic development and plasticity, neuronal survival, differentiation, as well as myelination. Neurotrophin-4 binds with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR)[1].
Verified Bioactivity
1. The ED50 is <5 μg/mL as measured by C6 cells, corresponding to a specific activity of >2.0 × 102 units/mg.
2. Measured by its binding ability in a functional ELISA. When Recombinant Human Neurotrophin-4 is present at 5 μg/mL, can bind Recombinant Mouse TrkB. The ED50 for this effect is 8.676 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Exp Eye Res
Neurotrophin-4 as a promising therapy for corneal injuries: Enhancing epithelial repair and nerve regeneration in abrasion and alkali burn models. [Abstract]2026 May:266:110917. PMID: 41679583
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P34130 (G81-A210)
-
Molecular Construction
-
N-term
-
Neurotrophin-4 (G81-A210)
Accession # P34130 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NTF4; Neutrophic Factor 4; Prev. NTF5; NT-4; Neurotrophin-4; NT-5; NT-4/5; Neurotrophic Factor 5; GLC1O; GLC10; Neurotrophin 5 (Neurotrophin 4/5); NT4; Neurotrophic Factor 4; NT5; Neurotrophin 4; Neurotrophin-5
-
AA Sequence
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.3 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)