1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. NT-4/5
  6. Neurotrophin-4 Protein, Human

Neurotrophin-4 Protein, Human

Cat. No.: HY-P7272
COA Handling Instructions

NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $120 In-stock
50 μg $340 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).

Background

Neurotrophin-4 (NT-4) is a member of the well-studied family of neurotrophins that regulate the development of neuronal networks by participating in the growth of neuronal processes, synaptic development and plasticity, neuronal survival, differentiation, as well as myelination. Neurotrophin-4 binds with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR)[1].

Biological Activity

1. The ED50 is <5 μg/mL as measured by C6 cells, corresponding to a specific activity of >2.0 × 102 units/mg.
2. Measured by its binding ability in a functional ELISA. When Recombinant Human Neurotrophin-4 is present at 5 μg/mL, can bind Recombinant Mouse TrkB. The ED50 for this effect is 8.676 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P34130 (G81-A210)

Gene ID
Molecular Construction
N-term
Neurotrophin-4 (G81-A210)
Accession # P34130
C-term
Synonyms
rHuNT-4; NT-5; NTF4; NTF5; NT4
AA Sequence

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Weight

Approximately 17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 50 mM acetic acid or PBS, pH 7.4.

Endotoxin Level

<0.3 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or 50 mM acetic acid. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Neurotrophin-4 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurotrophin-4 Protein, Human
Cat. No.:
HY-P7272
Quantity:
MCE Japan Authorized Agent: