1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands
  5. OX40 Ligand
  6. OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc)

OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc)

Art. -Nr.: HY-P77458
Handling Instructions Technical Support

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc) is a recombinant human OX40 Ligand (Q51-L183) with N-terminal hFc tag, which is produced in HEK293.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
> 100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc) is a recombinant human OX40 Ligand (Q51-L183) with N-terminal hFc tag, which is produced in HEK293.

Background

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is expressed on antigen-presenting cells, such as B cells, dendritic cells (DCs), and macrophages, and airway smooth muscle cells[3]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family.
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
Human OX40 Ligand shares <70% aa sequence identity with mouse, rat and rabbit.
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[4]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1].

In Vitro

OX4 Ligand (human, 1 ng/mL, 7 days, added into DC-T cell cultures at days and 4) inhibits the generation of IL-1-producing T cells induced by immature DCs and DCs treated with IL-1 and IFN-α[5].

Biologische Aktivität

Loaded Recombinant Human OX40 Ligand/TNFSF4 Protein, hFc Tag on ProA Biosensor, can bind Recombinant Human OX40/TNFRSF4 Protein, His Tag with an affinity constant of 0.909 μM as determined in BLI assay.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P23510-1 (Q51-L183)

Gene ID
Molecular Construction
N-term
hFc
OX40L (Q51-L183)
Accession # P23510-1
C-term
Protein Length

Extracellular Domain

Synonyms
CD134L; CD252; Glycoprotein Gp34; OX40 antigen ligand; OX40L; TXGP1
AA Sequence

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Predicted Molecular Mass
46.6 kDa
Molekulargewicht

Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Versand

Shipping with dry ice.

Dokumentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc)
Art. -Nr.:
HY-P77458
Menge:
MCE Japan Authorized Agent: