OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc)

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa^[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs^[1][2]. OX40 Ligand/TNFSF4 Protein, Human (HEK293, Fc) is a recombinant human OX40 Ligand (Q51-L183) with N-terminal hFc tag, which is produced in HEK293.

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa^[1]. OX40 Ligand is expressed on antigen-presenting cells, such as B cells, dendritic cells (DCs), and macrophages, and airway smooth muscle cells^[3]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family.
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs^[1][2].
Human OX40 Ligand shares <70% aa sequence identity with mouse, rat and rabbit.
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity^[4]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease^[1].

OX4 Ligand (human, 1 ng/mL, 7 days, added into DC-T cell cultures at days and 4) inhibits the generation of IL-1-producing T cells induced by immature DCs and DCs treated with IL-1 and IFN-α^[5].

Loaded Recombinant Human OX40 Ligand/TNFSF4 Protein, hFc Tag on ProA Biosensor, can bind Recombinant Human OX40/TNFRSF4 Protein, His Tag with an affinity constant of 0.909 μM as determined in BLI assay.

Human

HEK293

N-hFc

P23510-1 (Q51-L183)

7292  [NCBI]

Extracellular Domain

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.