Copy Link Print Information

P-selectin Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-selectin Protein, Human (HEK293, His) is the recombinant human-derived P-selectin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for P-selectin Protein, Human (HEK293, His)
  • Experimental Validation Results for P-selectin Protein, Human (HEK293, His)
  • P-selectin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-selectin Protein, Human (HEK293, His) is the recombinant human-derived P-selectin protein, expressed by HEK293 , with C-His labeled tag.

Background

P-selectin, a Ca(2+)-dependent receptor on myeloid cells, facilitates the binding to carbohydrates on neutrophils and monocytes, playing a crucial role in the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized by P-selectin is sialyl-Lewis X, and this interaction is pivotal for the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation, accomplished through engagement with SELPLG. Additionally, P-selectin forms interactions with SNX17 and mediates adhesion and rolling of neutrophils through its association with SELPLG/PSGL1 and PODXL2. This interaction is contingent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as the specific tyrosine sulfation on SELPLG.

Verified Bioactivity

1.Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 14.18 μg/mL, corresponding to a specific activity is 70.5219 units/mg.
2.Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce >50% adhesion on U937 cells (100 µL/well at 1 x 106cells/mL).

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells.The ED50 for this effect is 14.18 μg/mL, corresponding to a specific activity is 70.5219 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    P16109 (W42-A771, V640L)

  • Gene ID
    6403  [NCBI]
  • Molecular Construction
    • N-term
    • P-selectin (W42-A771, V640L)
      Accession # P16109
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SELP; Selectin P (Granule Membrane Protein 140kDa, Antigen CD62); Prev. GRMP; LECAM3; P-Selectin; Selectin P (Granule Membrane Protein 140kD, Antigen CD62); PADGEM; Leukocyte-Endothelial Cell Adhesion Molecule 2; Platelet Activation Dependent Granule-Exte

  • AA Sequence

    WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

  • Molecular Weight

    Approximately 110-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells.The ED50 for this effect is 14.18 μg/mL, corresponding to a specific activity is 70.5219 units/mg.

  • P-selectin Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for P-selectin Protein, Human (HEK293, His)
  • Experimental Validation Results for P-selectin Protein, Human (HEK293, His)
  • P-selectin Protein, Human (HEK293, His) Product Image