P-Selectin Protein, Rat (HEK293, Fc)

P-Selectin, a Ca(2+)-dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, Fc) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-hFc labeled tag.

P-Selectin protein is a Ca(2+)-dependent receptor found on myeloid cells that binds to carbohydrates present on neutrophils and monocytes. It plays a crucial role in facilitating the interaction between activated endothelial cells or platelets with leukocytes. The specific ligand recognized by P-Selectin is sialyl-Lewis X. Through its interaction with SELPLG, P-Selectin mediates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation. P-Selectin also interacts with SNX17 and facilitates neutrophil adhesion and leukocyte rolling. This interaction is dependent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as specific tyrosine sulfation on SELPLG.

Rat

HEK293

C-hFc

P98106/AAI01920.1 (W42-Q700)

25651  [NCBI]

Partial

WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.