P-Selectin Protein, Rat (HEK293, His)

P-Selectin, a Ca(2+)-dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag. The total length of P-Selectin Protein, Rat (HEK293, His) is 659 a.a., with molecular weight of ~115 kDa.

P-Selectin protein is a Ca(2+)-dependent receptor found on myeloid cells that binds to carbohydrates present on neutrophils and monocytes. It plays a crucial role in facilitating the interaction between activated endothelial cells or platelets with leukocytes. The specific ligand recognized by P-Selectin is sialyl-Lewis X. Through its interaction with SELPLG, P-Selectin mediates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation. P-Selectin also interacts with SNX17 and facilitates neutrophil adhesion and leukocyte rolling. This interaction is dependent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as specific tyrosine sulfation on SELPLG.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce 53.03% adhesion on U937 cells (100 µL/well at 1 x 10⁶ cells/mL).

Rat

HEK293

C-10*His

P98106 (W42-Q700)

25651  [NCBI]

WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

Approximately 115 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.