Copy Link Print Information

P-Selectin Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

P-Selectin, a Ca(2+)-dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for P-Selectin Protein, Rat (HEK293, His)
  • P-Selectin Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

P-Selectin, a Ca(2+)-dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.

Background

P-Selectin protein is a Ca(2+)-dependent receptor found on myeloid cells that binds to carbohydrates present on neutrophils and monocytes. It plays a crucial role in facilitating the interaction between activated endothelial cells or platelets with leukocytes. The specific ligand recognized by P-Selectin is sialyl-Lewis X. Through its interaction with SELPLG, P-Selectin mediates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation. P-Selectin also interacts with SNX17 and facilitates neutrophil adhesion and leukocyte rolling. This interaction is dependent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as specific tyrosine sulfation on SELPLG.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce 53.03% adhesion on U937 cells (100 µL/well at 1 x 106 cells/mL).

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-10*His
  • Accession

    P98106/AAI01920.1 (W42-Q700)

  • Gene ID
    25651  [NCBI]
  • Molecular Construction
    • N-term
    • P-Selectin (W42-Q700)
      Accession # P98106/AAI01920.1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    SELP; Selectin P (Granule Membrane Protein 140kDa, Antigen CD62); Prev. GRMP; LECAM3; P-Selectin; Selectin P (Granule Membrane Protein 140kD, Antigen CD62); PADGEM; Leukocyte-Endothelial Cell Adhesion Molecule 2; Platelet Activation Dependent Granule-Exte

  • AA Sequence

    WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

  • Molecular Weight

    Approximately 114 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • P-Selectin Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for P-Selectin Protein, Rat (HEK293, His)
  • P-Selectin Protein, Rat (HEK293, His) Product Image