p19INK4d Protein, Human (His)

The p19INK4d protein, a potent inhibitor, strongly interacts with CDK4 and CDK6, effectively impeding their activity. Specifically interacting with CDK6, p19INK4d reinforces its role as a regulator of cyclin-dependent kinase activity. This crucial role in cell cycle regulation involves restraining CDK4 and CDK6 functions, contributing to the modulation of key cellular processes. p19INK4d Protein, Human (GST) is the recombinant human-derived p19INK4d protein, expressed by E. coli , with N-GST labeled tag. The total length of p19INK4d Protein, Human (GST) is 166 a.a., with molecular weight of ~46 kDa.

The p19INK4d protein serves as a potent inhibitor by interacting strongly with CDK4 and CDK6, effectively impeding their activity. Additionally, p19INK4d specifically interacts with CDK6, reinforcing its role as a regulator of cyclin-dependent kinase activity. Through these interactions, p19INK4d plays a crucial role in cell cycle regulation by restraining the function of CDK4 and CDK6, contributing to the modulation of key cellular processes.

Measured by its binding ability in a functional ELISA. When Recombinant human p19INK4d at 10 μg/mL (100 μL/well) can bind biotinylated human CDK4. The ED₅₀ for this effect is 0.9121 μg/mL.

Human

E. coli

N-6*His

P55273 (D10-L166)

1032  [NCBI]

DRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.