p19INK4d Protein, Human (His)
Based on 1 Customer Validation
The p19INK4d protein, a potent inhibitor, strongly interacts with CDK4 and CDK6, effectively impeding their activity. Specifically interacting with CDK6, p19INK4d reinforces its role as a regulator of cyclin-dependent kinase activity. This crucial role in cell cycle regulation involves restraining CDK4 and CDK6 functions, contributing to the modulation of key cellular processes. p19INK4d Protein, Human (GST) is the recombinant human-derived p19INK4d protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The p19INK4d protein, a potent inhibitor, strongly interacts with CDK4 and CDK6, effectively impeding their activity. Specifically interacting with CDK6, p19INK4d reinforces its role as a regulator of cyclin-dependent kinase activity. This crucial role in cell cycle regulation involves restraining CDK4 and CDK6 functions, contributing to the modulation of key cellular processes. p19INK4d Protein, Human (GST) is the recombinant human-derived p19INK4d protein, expressed by E. coli , with N-GST labeled tag.
Background
The p19INK4d protein serves as a potent inhibitor by interacting strongly with CDK4 and CDK6, effectively impeding their activity. Additionally, p19INK4d specifically interacts with CDK6, reinforcing its role as a regulator of cyclin-dependent kinase activity. Through these interactions, p19INK4d plays a crucial role in cell cycle regulation by restraining the function of CDK4 and CDK6, contributing to the modulation of key cellular processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant human p19INK4d at 10 μg/mL (100 μL/well) can bind biotinylated human CDK4. The ED50 for this effect is 0.9121 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P55273 (D10-L166)
-
Molecular Construction
-
N-term
-
His
-
p19INK4d (D10-L166)
Accession # P55273 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CDKN2D; Cell Cycle Inhibitor, Nur77 Associating Protein; Cyclin Dependent Kinase Inhibitor 2D; Cyclin-Dependent Kinase 4 Inhibitor D P19; INK4D; Inhibitor Of Cyclin-Dependent Kinase 4d; P19; CDK Inhibitor P19INK4d; Cyclin-Dependent Kinase Inhibitor 2D (P1
-
AA Sequence
DRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)