1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PCSK9 Protein, Rat (HEK293, His)

The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PCSK9 Protein, Rat (HEK293, His)

WB
IF

    PCSK9 Protein, Rat (HEK293, His) purchased from MCE. Usage Cited in: Biochem Pharmacol. 2024 Feb:220:115996.  [Abstract]

    PCSK9 proteins (0, 10, 20, 40, 80, and 160 nM, 24 h) increased the protein levels of α-SMA, COL1A1, and COL1A2 (or COL1A1) in rat primary cardiac fibroblasts.

    PCSK9 Protein, Rat (HEK293, His) purchased from MCE. Usage Cited in: Biochem Pharmacol. 2024 Feb:220:115996.  [Abstract]

    PCSK9 proteins (40 nM, 24 h) increased the protein levels of pSTAT3, STAT3, JAK2, and pJAK2 in primary neonatal rat cardiac fibroblasts.

    PCSK9 Protein, Rat (HEK293, His) purchased from MCE. Usage Cited in: Biochem Pharmacol. 2024 Feb:220:115996.  [Abstract]

    PCSK9 proteins (40 nM, 24 h) increased the proliferation of cardiac fibroblasts, while treatment with S3I-201 attenuated this effect in primary neonatal rat cardiac fibroblasts.

    PCSK9 Protein, Rat (HEK293, His) purchased from MCE. Usage Cited in: Biochem Pharmacol. 2024 Feb:220:115996.  [Abstract]

    The outcomes from α-SMA immunofluorescence staining revealed that incubation with PCSK9 protein (40 nM, 24 h) or PCSK9 overexpression resulted in a higher percentage of α-SMA-positive cells in primary neonatal rat cardiac fibroblasts.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    Description

    The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

    Background

    The PCSK9 protein plays a pivotal role in the regulation of plasma cholesterol homeostasis, exerting its influence through interactions with members of the low-density lipid receptor family, including low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2). PCSK9 facilitates the degradation of these receptors within intracellular acidic compartments, employing a non-proteolytic mechanism to enhance hepatic LDLR degradation via a clathrin LDLRAP1/ARH-mediated pathway. Additionally, it may impede LDLR recycling from endosomes to the cell surface, directing it to lysosomes for degradation, and induce ubiquitination of LDLR, leading to subsequent degradation. Notably, PCSK9 extends its regulatory influence beyond LDLR, inhibiting the intracellular degradation of APOB independently of LDLR, and participating in the disposal of non-acetylated intermediates of BACE1 in the early secretory pathway. Furthermore, PCSK9's impact extends to epithelial Na(+) channel (ENaC)-mediated Na(+) absorption, reducing ENaC surface expression primarily through increased proteasomal degradation. The protein also modulates neuronal apoptosis by regulating LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.

    Biological Activity

    1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
    2.Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 1.1766-0.2335 μg/mL.

    • Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 0.2335 μg/mL.
    Species

    Rat

    Source

    HEK293

    Tag

    C-6*His

    Accession

    P59996 (Q31-Q691)

    Gene ID
    Molecular Construction
    N-term
    PCSK9 (Q31-Q691)
    Accession # P59996
    6*His
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Proprotein convertase subtilisin/kexin type 9; NARC-1; PC9; PCSK9
    AA Sequence

    QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLRIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAAAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEETVAAAICCRSRPSAKASWVHQ

    Molecular Weight

    Approximately 17.26 & 60.16kDa

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1. Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
    2. Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8, 8% trehalsoe.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation

    PCSK9 Protein, Rat (HEK293, His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    PCSK9 Protein, Rat (HEK293, His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    PCSK9 Protein, Rat (HEK293, His)
    Cat. No.:
    HY-P73340
    Quantity:
    MCE Japan Authorized Agent: