PDGF-AA Protein, Rat (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGF-AA Protein emerges as a pivotal growth factor orchestrating key aspects of embryonic development, including cell proliferation, migration, survival, and chemotaxis. Recognized for its potency as a mitogen for mesenchymal cells, PDGF-AA assumes essential roles in various physiological processes, such as the formation of lung alveolar septa, development of the gastrointestinal tract, Leydig cell maturation, spermatogenesis, oligodendrocyte development, and myelination in the spinal cord and cerebellum. Furthermore, PDGF-AA stands as a crucial contributor to wound healing dynamics. Its signaling intricacies involve modulation through heterodimer formation with PDGFB, underscoring its versatility in regulatory mechanisms. Structurally, PDGF-AA adopts a homodimeric configuration, characterized by an antiparallel disulfide-linked dimer. Additionally, it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, showcasing the complexity of its molecular interactions. Furthermore, PDGF-AA demonstrates an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED50 for this effect is 5 - 15 ng/mL.

Technical Parameters

  • Species Rat
  • Source P. pastoris
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • PDGF-AA (R86-K204)
      Accession # P28576-1
    • C-term
  • Protein Length

    Full Length of Isoform 1 Mature Protein

  • Synonyms

    PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu

  • AA Sequence

    RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

  • Predicted Molecular Mass

    14.8 kDa

  • Molecular Weight

    Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00