PDGF-AA Protein, Rat (P.pastoris, His)
Based on 1 Customer Validation
PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Rat
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.
Background
PDGF-AA Protein emerges as a pivotal growth factor orchestrating key aspects of embryonic development, including cell proliferation, migration, survival, and chemotaxis. Recognized for its potency as a mitogen for mesenchymal cells, PDGF-AA assumes essential roles in various physiological processes, such as the formation of lung alveolar septa, development of the gastrointestinal tract, Leydig cell maturation, spermatogenesis, oligodendrocyte development, and myelination in the spinal cord and cerebellum. Furthermore, PDGF-AA stands as a crucial contributor to wound healing dynamics. Its signaling intricacies involve modulation through heterodimer formation with PDGFB, underscoring its versatility in regulatory mechanisms. Structurally, PDGF-AA adopts a homodimeric configuration, characterized by an antiparallel disulfide-linked dimer. Additionally, it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, showcasing the complexity of its molecular interactions. Furthermore, PDGF-AA demonstrates an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.
Verified Bioactivity
Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED50 for this effect is 5 - 15 ng/mL.
Technical Parameters
-
Species Rat
-
Source P. pastoris
-
Tag N-8*His
-
Accession
P28576-1 (R86-K204)
-
Molecular Construction
-
N-term
-
8*His
-
PDGF-AA (R86-K204)
Accession # P28576-1 -
C-term
-
-
Protein Length
Full Length of Isoform 1 Mature Protein
-
Synonyms
PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu
-
AA Sequence
RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK
-
Predicted Molecular Mass
14.8 kDa
-
Molecular Weight
Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)