PDGF-AA Protein, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag. The total length of PDGF-AA Protein, Rat (P.pastoris, His) is 110 a.a., with molecular weight of ~14.5 kDa.

PDGF-AA Protein emerges as a pivotal growth factor orchestrating key aspects of embryonic development, including cell proliferation, migration, survival, and chemotaxis. Recognized for its potency as a mitogen for mesenchymal cells, PDGF-AA assumes essential roles in various physiological processes, such as the formation of lung alveolar septa, development of the gastrointestinal tract, Leydig cell maturation, spermatogenesis, oligodendrocyte development, and myelination in the spinal cord and cerebellum. Furthermore, PDGF-AA stands as a crucial contributor to wound healing dynamics. Its signaling intricacies involve modulation through heterodimer formation with PDGFB, underscoring its versatility in regulatory mechanisms. Structurally, PDGF-AA adopts a homodimeric configuration, characterized by an antiparallel disulfide-linked dimer. Additionally, it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, showcasing the complexity of its molecular interactions. Furthermore, PDGF-AA demonstrates an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED₅₀ for this effect is 5 - 15 ng/mL.

Rat

P. pastoris

N-His

P28576 (R86-K204)

25266  [NCBI]

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

17-22 kDa & 25-45 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.