1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGF & PDGFR
  4. PDGF
  5. PDGF-AA Protein, Mouse

PDGF-AA Protein, Mouse

Cat. No.: HY-P7277
Handling Instructions

PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

PDGF-AA Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products

PDGF-AA Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P20033 (S87-T211)

Gene ID

18590

Synonyms
rMuPDGF-AA; PDGF-1; Pdgfa
AA Sequence

MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT

Molecular Weight

Approximately 28.7 kDa

Biological Activity
The ED50 is <50 ng/mL as measured by 3T3 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 1× PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Platelet-Derived Growth Factor-AA is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor[1]. PDGF-AA may play a crucial role in the ability of ASCs and EPCs to enhance wound healing, especially in animal models with wound-healing deficits[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-AA Protein, Mouse
Cat. No.:
HY-P7277
Quantity:
MCE Japan Authorized Agent: