PDGF-BB Protein, Bovine (P. pastoris)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development. Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis. PDGF-BB Protein, Bovine (P. pastoris) is the recombinant bovine-derived PDGF-BB protein, expressed by P. pastoris , with tag free.

The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Bovine

P. pastoris

Tag Free

B1H0W5 (S82-T190)

540106

Partial

SLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVVARAVT

Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

< 0.1 EU/μg of protein by gel clotting method