PDGF-BB Protein, Bovine (P. pastoris)
Based on 1 Customer Validation
PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development. Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis. PDGF-BB Protein, Bovine (P. pastoris) is the recombinant bovine-derived PDGF-BB protein, expressed by P. pastoris , with tag free.
- Species: Bovine
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development. Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis. PDGF-BB Protein, Bovine (P. pastoris) is the recombinant bovine-derived PDGF-BB protein, expressed by P. pastoris , with tag free.
Background
The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.
Verified Bioactivity
Measure by its ability by a dose-response proliferation assay using murine Balb/c 3T3 cells. The ED50 for this effect is <20 ng/mL. The specific activity of this protein is > 0.5 × 105 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)
Technical Parameters
-
Species Bovine
-
Source P. pastoris
-
Tag Tag Free
-
Accession
B1H0W5 (S82-T190)
-
Gene ID540106
-
Molecular Construction
-
N-term
-
PDGF-BB (S82-T190)
Accession # B1H0W5 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVVARAVT
-
Predicted Molecular Mass
12 kDa
-
Molecular Weight
Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM NaAc, pH 5.0.
< 0.1 EU/μg of protein by gel clotting method
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
