PRKCE Protein, Human (His)
PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.
Background
PKCE, a calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase, plays pivotal roles in regulating diverse cellular processes associated with cytoskeletal proteins, including cell adhesion, motility, migration, and cell cycle control. In cardiac fibroblasts, PKCE mediates angiotensin-2-induced integrin beta-1 (ITGB1) activation, facilitating cell adhesion to the extracellular matrix. It phosphorylates MARCKS, leading to PTK2/FAK activation and subsequent cardiomyocyte spreading. In mesenchymal cells, PKCE governs the directional transport of ITGB1 by phosphorylating vimentin (VIM). In epithelial cells, it associates with and phosphorylates keratin-8 (KRT8), influencing desmoplakin targeting at desmosomes and regulating cell-cell contact. Additionally, PKCE phosphorylates IQGAP1, promoting epithelial cell detachment prior to migration. In various contexts, such as HGF-induced cell migration, wound healing, and cytokinesis, PKCE demonstrates its versatility in coordinating complex cellular events. It also plays crucial roles in cardiac myocytes, nerve growth factor (NGF)-induced neurite outgrowth, and immune responses. Notably, PKCE influences prostate cancer cell invasion through phosphorylation of STAT3 and participates in the LPS-induced immune response via TICAM2/TRAM activation. In differentiating erythroid progenitors, PKCE is regulated by EPO, providing protection against TNFSF10/TRAIL-mediated apoptosis. Additionally, PKCE is implicated in insulin-induced phosphorylation and activation of AKT1, as well as the modulation of AKT pathway activation in cumulus cells through NLRP5/MATER phosphorylation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q02156 (Q580-P737)
-
Molecular Construction
-
N-term
-
PKCE (Q580-P737)
Accession # Q02156 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PRKCE; PKCE; Protein Kinase C Epsilon; Non-Specific Serine/Threonine Protein Kinase; Protein Kinase C Epsilon Type; Protein Kinase C, Epsilon; NPKC-Epsilon
-
AA Sequence
QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
-
Predicted Molecular Mass
19.6 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)