PRKCE Protein, Human (His)

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

Background

PKCE, a calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase, plays pivotal roles in regulating diverse cellular processes associated with cytoskeletal proteins, including cell adhesion, motility, migration, and cell cycle control. In cardiac fibroblasts, PKCE mediates angiotensin-2-induced integrin beta-1 (ITGB1) activation, facilitating cell adhesion to the extracellular matrix. It phosphorylates MARCKS, leading to PTK2/FAK activation and subsequent cardiomyocyte spreading. In mesenchymal cells, PKCE governs the directional transport of ITGB1 by phosphorylating vimentin (VIM). In epithelial cells, it associates with and phosphorylates keratin-8 (KRT8), influencing desmoplakin targeting at desmosomes and regulating cell-cell contact. Additionally, PKCE phosphorylates IQGAP1, promoting epithelial cell detachment prior to migration. In various contexts, such as HGF-induced cell migration, wound healing, and cytokinesis, PKCE demonstrates its versatility in coordinating complex cellular events. It also plays crucial roles in cardiac myocytes, nerve growth factor (NGF)-induced neurite outgrowth, and immune responses. Notably, PKCE influences prostate cancer cell invasion through phosphorylation of STAT3 and participates in the LPS-induced immune response via TICAM2/TRAM activation. In differentiating erythroid progenitors, PKCE is regulated by EPO, providing protection against TNFSF10/TRAIL-mediated apoptosis. Additionally, PKCE is implicated in insulin-induced phosphorylation and activation of AKT1, as well as the modulation of AKT pathway activation in cumulus cells through NLRP5/MATER phosphorylation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PKCE (Q580-P737)
      Accession # Q02156
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PRKCE; PKCE; Protein Kinase C Epsilon; Non-Specific Serine/Threonine Protein Kinase; Protein Kinase C Epsilon Type; Protein Kinase C, Epsilon; NPKC-Epsilon

  • AA Sequence

    QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00