PLA2G2D Protein, Human (His-SUMO)

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of PLA2G2D Protein, Human (His-SUMO) is 124 a.a., with molecular weight of ~30.5 kDa.

PLA2G2D is a secretory calcium-dependent phospholipase A2 with a primary focus on extracellular lipids, showcasing anti-inflammatory and immunosuppressive functions. This protein hydrolyzes the ester bond of the fatty acyl group at the sn-2 position of phospholipids, displaying a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. Particularly in draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids like eicosapentaenoate and docosahexaenoate. These compounds act as precursors for the synthesis of anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D drives the synthesis of resolvin D1 derived from docosahexaenoate, suppressing dendritic cell activation and the T-helper 1 immune response. Beyond its catalytic activity, PLA2G2D, via mechanisms independent of its enzymatic functions, promotes the differentiation of regulatory T cells (Tregs) and contributes to maintaining immune tolerance. Additionally, it may play a role in lipid remodeling of cellular membranes and participate in the generation of lipid mediators crucial for pathogen clearance, exhibiting bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids in the bacterial membrane.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His;N-SUMO

Q9UNK4 (22I-145C)

26279  [NCBI]

ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Approximately 30.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.