PLA2G2D Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

PLA2G2D is a secretory calcium-dependent phospholipase A2 with a primary focus on extracellular lipids, showcasing anti-inflammatory and immunosuppressive functions. This protein hydrolyzes the ester bond of the fatty acyl group at the sn-2 position of phospholipids, displaying a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. Particularly in draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids like eicosapentaenoate and docosahexaenoate. These compounds act as precursors for the synthesis of anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D drives the synthesis of resolvin D1 derived from docosahexaenoate, suppressing dendritic cell activation and the T-helper 1 immune response. Beyond its catalytic activity, PLA2G2D, via mechanisms independent of its enzymatic functions, promotes the differentiation of regulatory T cells (Tregs) and contributes to maintaining immune tolerance. Additionally, it may play a role in lipid remodeling of cellular membranes and participate in the generation of lipid mediators crucial for pathogen clearance, exhibiting bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids in the bacterial membrane.

Verified Bioactivity

Measured by its ability to hydrolyze 20 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine. The specific activity is >5 pmol/min/μg that at room temperature in kinetic mode for 5 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • PLA2G2D (22I-145C)
      Accession # Q9UNK4
    • C-term
  • Protein Length

    Full Length of Group IID secretory phospholipase A2 Chain

  • Synonyms

    PLA2G2D; GIID SPLA2; Phospholipase A2 Group IID; SPLA2-IID; SPLA2S; PLA2IID; Secretory-Type PLA, Stroma-Associated Homolog; SPLASH; Phosphatidylcholine 2-Acylhydrolase 2D; Phospholipase A2, Group IID; Group IID Secretory Phospholipase A2; Secretory Phosph

  • AA Sequence

    ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 8.2, 0.2% CHAPS, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00