PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc)

For research use only. We do not sell to patients.

* Please select Quantity before adding items.

Species	Mouse
Source	HEK293
Tag	C-Myc;N-10*His
Accession	Q60963 (F22-N440)
Gene ID	27226 [NCBI]
Synonyms	PLA2G7; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL PLA2; PAFAH; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; PAFAD; LP-PLA2; LDL-PLA2;
AA Sequence	FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN
Molecular Weight	51.9 kDa
Purity	Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Documentation	Data Sheet (237 KB) Handling Instructions (2659 KB)

PLA2G7 Protein, Mouse (HEK293, N-His, C-Myc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.