Copy Link Print Information

PVR/CD155 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PVR/CD155 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for PVR/CD155 Protein, Human (HEK293, Fc)
  • PVR/CD155 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.

Background

CD155 is a Type I transmembrane glycoprotein in the immunoglobulin superfamily[1]. Commonly known as Poliovirus Receptor (PVR) due to its involvement in the cellular poliovirus infection in primates, CD155's normal cellular function is in the establishment of intercellular adherens junctions between epithelial cells. The role of CD155 in the immune system is unclear, though it may be involved in intestinal humoral immune responses. CD155 may also be used to positively select MHC-independent T cells in the thymus[2].

Verified Bioactivity

1.5 µg/mL (100 µL/well) of immoblized recombinant human PVR/CD155-Fc can bind human Biotin-TIGIT-Fc with a linear range of 6.1-48.8 ng/mL.
2.Immobilized human CD226 (HY-P70829) at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is <100 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P15151-1 (W21-N343)

  • Gene ID
    5817  [NCBI]
  • Molecular Construction
    • N-term
    • PVR (W21-N343)
      Accession # P15151-1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PVR; Tage4; Prev. PVS; Nectin-Like Protein 5; Poliovirus Receptor; Poliovirus Receptor, Isoform CRA_c; Necl-5; Nectin-Like 5; CD155; CD155 Antigen; NECL5; NECL-5; PVR Cell Adhesion Molecule; HVED

  • AA Sequence

    WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

  • Molecular Weight

    Approximately 70-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose and mannitol.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Mendelsohn CL, et al. Cellular receptor for poliovirus: molecular cloning, nucleotide sequence, and expression of a new member of the immunoglobulin superfamily. Cell. 1989 Mar 10;56(5):855-65. [Content Brief]

[2]. Maier MK, et al. The adhesion receptor CD155 determines the magnitude of humoral immune responses against orally ingested antigens. Eur J Immunol. 2007 Aug;37(8):2214-25. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.

  • PVR/CD155 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for PVR/CD155 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for PVR/CD155 Protein, Human (HEK293, Fc)
  • PVR/CD155 Protein, Human (HEK293, Fc) Product Image