PVR/CD155 Protein, Human (HEK293, Fc)

PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.

CD155 is a Type I transmembrane glycoprotein in the immunoglobulin superfamily^[1]. Commonly known as Poliovirus Receptor (PVR) due to its involvement in the cellular poliovirus infection in primates, CD155's normal cellular function is in the establishment of intercellular adherens junctions between epithelial cells. The role of CD155 in the immune system is unclear, though it may be involved in intestinal humoral immune responses. CD155 may also be used to positively select MHC-independent T cells in the thymus^[2].

1. 5 µg/mL (100 µL/well) of immoblized recombinant human PVR/CD155-Fc can bind human Biotin-TIGIT-Fc with a linear range of 6.1-48.8 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED₅₀ for this effect is <100 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED₅₀ for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×10⁴ Unit/mg.

Human

HEK293

C-hFc

P15151-1 (W21-N343)

5817  [NCBI]

Extracellular Domain

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

80-105 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose and mannitol.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mendelsohn CL, et al. Cellular receptor for poliovirus: molecular cloning, nucleotide sequence, and expression of a new member of the immunoglobulin superfamily. Cell. 1989 Mar 10;56(5):855-65.  [Content Brief]

  [2]. Maier MK, et al. The adhesion receptor CD155 determines the magnitude of humoral immune responses against orally ingested antigens. Eur J Immunol. 2007 Aug;37(8):2214-25.  [Content Brief]