1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. PVR/CD155
  6. PVR/CD155 Protein, Human (HEK293, Fc)

PVR/CD155 Protein, Human (HEK293, Fc)

Cat. No.: HY-P7401
COA Handling Instructions

PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $53 In-stock
50 μg $147 In-stock
100 μg $250 In-stock
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.

Background

CD155 is a Type I transmembrane glycoprotein in the immunoglobulin superfamily[1]. Commonly known as Poliovirus Receptor (PVR) due to its involvement in the cellular poliovirus infection in primates, CD155's normal cellular function is in the establishment of intercellular adherens junctions between epithelial cells. The role of CD155 in the immune system is unclear, though it may be involved in intestinal humoral immune responses. CD155 may also be used to positively select MHC-independent T cells in the thymus[2].

Biological Activity

1. 5 µg/mL (100 µL/well) of immoblized recombinant human PVR/CD155-Fc can bind human Biotin-TIGIT-Fc with a linear range of 6.1-48.8 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P15151 (W21-N343)

Gene ID
Synonyms
rHuPVR/CD155, Fc Chimera; Poliovirus receptor; NECL-5; PVS
AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Molecular Weight

80-105 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, 5% trehalose and mannitol or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVR/CD155 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7401
Quantity:
MCE Japan Authorized Agent: