1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RAC1 Protein, Human (sf9, GST)

The RAC1 protein is a plasma membrane-associated small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active form, RAC1 regulates processes such as secretory function, phagocytosis, cell polarization, neuronal activity, and growth factor-induced membrane ruffle formation. RAC1 Protein, Human (sf9, GST) is the recombinant human-derived RAC1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RAC1 protein is a plasma membrane-associated small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active form, RAC1 regulates processes such as secretory function, phagocytosis, cell polarization, neuronal activity, and growth factor-induced membrane ruffle formation. RAC1 Protein, Human (sf9, GST) is the recombinant human-derived RAC1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

Background

The RAC1 Protein, a plasma membrane-associated small GTPase, dynamically cycles between its active GTP-bound and inactive GDP-bound states, exerting regulatory control over a spectrum of cellular responses. In its active state, RAC1 binds to various effector proteins, modulating processes such as secretory functions, phagocytosis of apoptotic cells, epithelial cell polarization, neuronal adhesion, migration, differentiation, and growth-factor-induced formation of membrane ruffles. It forms an active heterodimer with Rho GDI in the cytosol, known as sigma 1, participating in the stimulation of NADPH oxidase activity in macrophages. Essential for SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly, RAC1 also stimulates PKN2 kinase activity. It collaborates with RAB7A to regulate the formation of ruffled borders in osteoclasts and promotes the nuclear shuttling of NR3C2 in podocytes for proper kidney functioning. In neurons, RAC1 is involved in dendritic spine formation, synaptic plasticity, spine morphogenesis, and synapse formation, highlighting its multifaceted role in neurobiology. Furthermore, RAC1 plays a crucial role in regulating GABA(A) receptor synaptic stability and GABAergic inhibitory synaptic transmission through PAK1 activation and F-actin stabilization. The isoform B of RAC1 exhibits distinctive features in its GEF-independent GDP/GTP exchange and impaired GTP hydrolysis, partially restored by GTPase-activating proteins, suggesting nuanced regulatory mechanisms in its effector interactions.

Biological Activity

Measured by its ability to catalyze 4 μM substrate GTP that incubate at room temperature for 60 minutes. The specific activity is 15.0 nmol/min/mg.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

P63000-1 (M1-C189)

Gene ID
Molecular Construction
N-term
GST
RAC1 (M1-C189)
Accession # P63000-1
C-term
Protein Length

Full Length of Isoform 1 Mature Protein

Synonyms
Ras-related C3 botulinum toxin substrate 1; p21-Rac1; RAC1; TC25; MIG5
AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC

Predicted Molecular Mass
47 kDa
Molecular Weight

Approximately 44 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 1 mM GSH, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RAC1 Protein, Human (sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RAC1 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAC1 Protein, Human (sf9, GST)
Cat. No.:
HY-P74608
Quantity:
MCE Japan Authorized Agent: