S100A4 Protein, Human (C-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with C-6*His labeled tag.

S100A4 protein, a calcium-binding molecule, plays a versatile role in numerous cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Functionally, it enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, promoting filament depolymerization and increasing the amount of soluble myosin-IIA to facilitate chemotaxis. Additionally, S100A4 modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to a reduction in TP53 protein levels. In the extracellular space, it stimulates cytokine production and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. The protein forms homodimers and interacts with various partners, including PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, and FCGR3A, each interaction contributing to its diverse cellular functions. This intricate network of interactions underscores the multifaceted role of S100A4 in orchestrating cellular responses across different pathways.

Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 0.5755 ng/mL , corresponding to a specific activity is 1.73×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 0.5755 ng/mL , corresponding to a specific activity is 1.73×10⁶ units/mg.

Human

E. coli

C-6*His

P26447 (M1-K101)

6275  [NCBI]

Full Length

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Approximately 13.0 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 6% sucrose, 4% mannitol, 50 mM NaCl, 0.05% Tween 80, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.