Copy Link Print Information

S100A8-S100A9 Heterodimer Protein, Human (His, solution)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • S100A8-S100A9 Heterodimer Protein, Human (His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Background

The S100A8, consisting of calcium- and zinc-binding S100A8, plays a crucial role in regulating inflammatory processes and immune responses. Often found as calprotectin (S100A8/A9), it serves diverse intracellular functions, including facilitating leukocyte arachidonic acid trafficking and metabolism, modulating the tubulin-dependent cytoskeleton during phagocyte migration, and activating the neutrophilic NADPH-oxidase. In particular, it activates NADPH-oxidase by aiding in the assembly of the enzyme complex at the cell membrane, transferring arachidonic acid, and directly binding to NCF2/P67PHOX. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities. Acting as an alarmin or danger-associated molecular pattern (DAMP) molecule, S100A8 stimulates innate immune cells through binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways and amplifying the pro-inflammatory cascade. With antimicrobial activity against bacteria and fungi, it likely exerts this effect through Zn(2+) chelation essential for microbial growth. Additionally, S100A8/A9 induces cell death via autophagy and apoptosis, regulates neutrophil number and apoptosis, and acts as an oxidant scavenger to prevent tissue damage. Its role as an amplifier of inflammation in autoimmunity and cancer development is notable, and in microbial infection, such as by SARS-CoV-2, it may induce expansion of aberrant immature neutrophils in a TLR4-dependent manner.

Verified Bioactivity

1.Measured by its ability to induce IL-6 secretion by A375 human melanoma cells. The ED50 for this effect is 1.0-10.0 μg/mL.
2.Immobilized Recombinant Human S100A8/A9 Heterodimer (C 6His) at 2 μg/mL (100 μl/well) can bind Anti-Human S100A9 Antibody. The ED50 of Anti-Human S100A9 Antibody is 9.91 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by A375 human melanoma cells. The ED50 for this effect is 1.544 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P05109 (M1-E93) (S100A8)&P06702 (T2-P114) (S100A9)

  • Gene ID
    6279  [NCBI]&6280  [NCBI]
  • Molecular Construction
    • N-term
    • S100A8 (M1-E93)
      Accession # P05109
    • 6*His
    • C-term
    • N-term
    • S100A9 (T2-P114)
      Accession # P06702
    • 6*His
    • C-term
  • Synonyms

    S100A8; MRP-8; Prev. CAGA; Urinary Stone Protein Band A; Prev. CFAG; Protein S100-A8; MRP8; Calgranulin A; P8; S100 Calcium-Binding Protein A8; Migration Inhibitory Factor-Related Protein 8; Calgranulin-A; Leukocyte L1 Complex Light Chain; CP-10; Calprotectin L1L Subunit; MA387; Cystic Fibrosis Antigen; L1Ag; S100-A8; NIF; 60B8AG; S100 Calcium Binding Protein A8; CGLA; S100A9; 60B8AG; Prev. CAGB; CGLB; Prev. CFAG; MIF; MRP-14; NIF; MRP14; Protein S100-A9; P14; Calgranulin B; Migration Inhibitory Factor-Related Protein 14; S100 Calcium-Binding Protein A9 (Calgranulin B); Leukocyte L1 Complex Heavy Chain; S100 Calcium-Binding Protein A9; Calprotectin L1H Subunit; Calgranulin-B; S100-A9; L1AG; MAC387; S100 Calcium Binding Protein A9; LIAG

  • AA Sequence

    A1:
    MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
    A2:
    TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

  • Molecular Weight

    Approximately 13 kDa & 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 10% Glycerol, 150 mM NaCl, 2.5 mM EDTA, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 300 mM NaCl, 200 mM Arginine, pH 7.5.
3.Supplied as a 0.22 μm filtered solution of PBS, 2 mM DTT, pH 8.0.
4.Supplied as a 0.22 μm filtered solution of PBS, 5 mM TCEP, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-6 secretion by A375 human melanoma cells. The ED50 for this effect is 1.544 μg/mL.

  • 1/16

    S100A8-S100A9 Heterodimer Protein, Human (His, solution) purchased from MedChemExpress. Usage Cited in: Respir Res. 2023 Nov 17;24(1):288. [Abstract]

    Customer Validation
     S100A8-S100A9 Heterodimer Protein, Human (His, solution) (rhS100A8/A9, 2.0 µg/mL; 2 h) induced endothelial barrier dysfunction in human umbilical vein endothelial cells (HUVEC). Following rhS100A8/A9 treatment, the expression levels of occludin and VE‑cadherin were significantly reduced, while the protein levels of phosphorylated ERK (p‑ERK) and phosphorylated p38 (p‑p38) were markedly elevated. Meanwhile, the expression of the anti‑apoptotic protein Bcl2 was obviously decreased, whereas no statistically significant change was detected in the expression of the pro‑apoptotic protein Bax (n=6).

  • S100A8-S100A9 Heterodimer Protein, Human (His, solution) Product Image
    1/16
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • Experimental Validation Results for S100A8-S100A9 Heterodimer Protein, Human (His, solution)
  • S100A8-S100A9 Heterodimer Protein, Human (His, solution) Product Image

  • S100A8-S100A9 Heterodimer Protein, Human (His, solution) purchased from MedChemExpress. Usage Cited in: Respir Res. 2023 Nov 17;24(1):288. [Abstract]

    S100A8-S100A9 Heterodimer Protein, Human (His, solution) (rhS100A8/A9, 2.0 µg/mL; 2 h) induced endothelial barrier dysfunction in human umbilical vein endothelial cells (HUVEC). Following rhS100A8/A9 treatment, the expression levels of occludin and VE‑cadherin were significantly reduced, while the protein levels of phosphorylated ERK (p‑ERK) and phosphorylated p38 (p‑p38) were markedly elevated. Meanwhile, the expression of the anti‑apoptotic protein Bcl2 was obviously decreased, whereas no statistically significant change was detected in the expression of the pro‑apoptotic protein Bax (n=6).