Copy Link Print Information

Serpin A10 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Serpin A10 Protein, Human (HEK293, His)
  • Serpin A10 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Serpin A10 protein functions as an inhibitor of coagulation proteases, specifically factor Xa, in the presence of PROZ, calcium, and phospholipids. Moreover, it can inhibit factor XIa even in the absence of cofactors. The protein interacts with PROZ to exert its inhibitory effects on these coagulation factors.

Verified Bioactivity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide 20 μM substrate Mca-RPKPVE-Nval-WRK(Dnp)-NH2(HY-P2185A) that incubate at room temperature for 30 minutes. The IC50 value is 182.51 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9UK55 (L22-L444)

  • Gene ID
    51156  [NCBI]
  • Molecular Construction
    • N-term
    • Serpin A10 (L22-L444)
      Accession # Q9UK55
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SERPINA10; Protein-Z Dependent Proteinase Inhibitor; Serpin Family A Member 10; Protein Z-Dependent Protease Inhibitor; PZI; PZ-Dependent Protease Inhibitor; ZPI; Serpin A10; Serine (Or Cysteine) Proteinase Inhibitor, Clade A (Alpha-1 Antiproteinase, Anti

  • AA Sequence

    LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL

  • Molecular Weight

    Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Serpin A10 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Serpin A10 Protein, Human (HEK293, His)
  • Serpin A10 Protein, Human (HEK293, His) Product Image