Serpin A10 Protein, Human (HEK293, His)

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin A10 Protein, Human (HEK293, His) is 423 a.a., with molecular weight of 55-80 kDa.

Serpin A10 protein functions as an inhibitor of coagulation proteases, specifically factor Xa, in the presence of PROZ, calcium, and phospholipids. Moreover, it can inhibit factor XIa even in the absence of cofactors. The protein interacts with PROZ to exert its inhibitory effects on these coagulation factors.

Human

HEK293

C-6*His

Q9UK55 (L22-L444)

51156  [NCBI]

LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL

55-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM GaCl₂, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.