1. Recombinant Proteins
  2. Receptor Proteins
  3. SIGIRR Protein, Human (HEK293, Fc)

SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, Fc) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, Fc) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The SIGIRR protein acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It functions by inhibiting the recruitment of signaling components to the TLR4 receptor, likely through an interaction between their TIR domains. Furthermore, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP through its extracellular domain. It interacts with various proteins including IL1R1, IRAK1, TLR4, TLR5, TLR9, TRAF6, and PALM3. Upon IL-1 stimulation, SIGIRR can be found in a complex consisting of IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Similarly, upon stimulation with LPC, SIGIRR is present in a complex comprising TLR4, SIGIRR, MYD88, IRAK1, and TRAF6.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6IA17-1 (M1-H118)

Gene ID
Molecular Construction
N-term
SIGIRR (M1-H118)
Accession # Q6IA17-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Single Ig IL-1-related receptor; Toll/interleukin-1 receptor 8; TIR8
AA Sequence

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH

Molecular Weight

50-70 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SIGIRR Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SIGIRR Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIGIRR Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76064
Quantity:
MCE Japan Authorized Agent: