SIGIRR Protein, Human (HEK293, His)

SIGIRR Protein functions as a negative regulator of Toll-like and IL-1R receptor signaling pathways. It inhibits recruitment of signaling components to TLR4 receptor through TIR domain interaction. SIGIRR also hinders heterodimerization of Il1R1 and IL1RAP via its extracellular domain. It interacts with IL1R1, IRAK1, TLR4, TLR5, TLR9, TRAF6, and PALM3. Upon IL-1 stimulation, SIGIRR forms complex with IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Similarly, upon LPC stimulation, SIGIRR is part of complex including TLR4, SIGIRR, MYD88, IRAK1, and TRAF6. SIGIRR Protein, Human (HEK293, His) is the recombinant human-derived SIGIRR protein, expressed by HEK293, with C-His labeled tag. The total length of SIGIRR Protein, Human (HEK293, His) is 118 a.a., with molecular weight of ~22-35 kDa.

The SIGIRR protein acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It functions by inhibiting the recruitment of signaling components to the TLR4 receptor, likely through an interaction between their TIR domains. Furthermore, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP through its extracellular domain. It interacts with various proteins including IL1R1, IRAK1, TLR4, TLR5, TLR9, TRAF6, and PALM3. Upon IL-1 stimulation, SIGIRR can be found in a complex consisting of IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Similarly, upon stimulation with LPC, SIGIRR is present in a complex comprising TLR4, SIGIRR, MYD88, IRAK1, and TRAF6.

Human

HEK293

C-His

Q6IA17 (M1-H118)

59307  [NCBI]

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH

The protein migrates as approximately 22-35 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.