SIGIRR Protein, Human (HEK293, His)
Based on 1 Customer Validation
SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, His) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, His) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-His labeled tag.
Background
The SIGIRR protein acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It functions by inhibiting the recruitment of signaling components to the TLR4 receptor, likely through an interaction between their TIR domains. Furthermore, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP through its extracellular domain. It interacts with various proteins including IL1R1, IRAK1, TLR4, TLR5, TLR9, TRAF6, and PALM3. Upon IL-1 stimulation, SIGIRR can be found in a complex consisting of IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Similarly, upon stimulation with LPC, SIGIRR is present in a complex comprising TLR4, SIGIRR, MYD88, IRAK1, and TRAF6.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q6IA17-1 (M1-H118)
-
Molecular Construction
-
N-term
-
SIGIRR (M1-H118)
Accession # Q6IA17-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SIGIRR; Single Ig IL-1R-Related Molecule; Single Ig And TIR Domain Containing; Single Ig IL-1-Related Receptor; Toll/Interleukin-1 Receptor 8; IL-1R8; TIR8; Single Immunoglobulin And Toll-Interleukin 1 Receptor (TIR) Domain; Single Immunoglobulin Domain-C
-
AA Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
