1. Recombinant Proteins
  2. Others
  3. SLPI Protein, Human (107a.a, Sf9, His)

SLPI Protein, Human (107a.a, Sf9, His)

Cat. No.: HY-P73414
COA Handling Instructions

The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (107a.a, Sf9, His) is the recombinant human-derived SLPI protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of SLPI Protein, Human (107a.a, Sf9, His) is 107 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg $140 In-stock
50 μg $385 In-stock
100 μg $683 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (107a.a, Sf9, His) is the recombinant human-derived SLPI protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of SLPI Protein, Human (107a.a, Sf9, His) is 107 a.a..

Background

SLPI, an acid-stable proteinase inhibitor, exhibits robust affinities for trypsin, chymotrypsin, elastase, and cathepsin G, as demonstrated in various studies. It plays a crucial role in modulating inflammatory and immune responses following bacterial infection, as well as infection by the intracellular parasite L.major. Additionally, SLPI contributes to down-regulating responses to bacterial lipopolysaccharide (LPS) (By similarity) and is involved in regulating the activation of NF-kappa-B, thereby influencing inflammatory responses. Notably, SLPI exhibits antimicrobial activity against mycobacteria but not against salmonella, contributing to normal resistance against infection by M.tuberculosis. It is also essential for normal resistance to infection by L.major and plays a critical role in wound healing, likely by preventing tissue damage through the regulation of protease activity (By similarity). Furthermore, in collaboration with ELANE, SLPI is required for the normal differentiation and proliferation of bone marrow myeloid cells, and it interacts with GRN, protecting progranulin from proteolysis.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK (Dnp)-NH2 and the IC50 value is ≤2.55 nM.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P03973 (S26-A132)

Gene ID
Molecular Construction
N-term
SLPI (S26-A132)
Accession # P03973
His
C-term
Synonyms
Antileukoproteinase; ALP; BLPI; SLPI; MPI; WAP4; WFDC4
AA Sequence

SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Molecular Weight

Approximately 16-19 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SLPI Protein, Human (107a.a, Sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLPI Protein, Human (107a.a, Sf9, His)
Cat. No.:
HY-P73414
Quantity:
MCE Japan Authorized Agent: