1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Smad Family
  5. SMAD3
  6. SMAD3 Protein, Human (Flag-His)

SMAD3 Protein, Human (Flag-His)

Cat. No.: HY-P71323
COA Handling Instructions

The SMAD3 protein acts as a receptor-regulated SMAD (R-SMAD), transducing signals from TGF-β and activin type 1 receptor kinase. After being activated by antigen-presenting cells, SMAD3 binds to the TRE element in the gene promoter and forms a complex with SMAD4 to activate transcription. SMAD3 Protein, Human (Flag-His) is the recombinant human-derived SMAD3 protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SMAD3 Protein, Human (Flag-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SMAD3 protein acts as a receptor-regulated SMAD (R-SMAD), transducing signals from TGF-β and activin type 1 receptor kinase. After being activated by antigen-presenting cells, SMAD3 binds to the TRE element in the gene promoter and forms a complex with SMAD4 to activate transcription. SMAD3 Protein, Human (Flag-His) is the recombinant human-derived SMAD3 protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Background

SMAD3 protein functions as a receptor-regulated SMAD (R-SMAD), serving as an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. Upon activation by antigen-presenting cells, SMAD3 binds the TRE element in gene promoters regulated by TGF-beta and, in conjunction with SMAD4, forms a complex that activates transcription. Additionally, it can assemble a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. SMAD3 exhibits an inhibitory effect on wound healing, potentially by modulating the growth and migration of primary keratinocytes and altering TGF-mediated monocyte chemotaxis, and this effect appears to be hormone-sensitive. Moreover, SMAD3 serves as a regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. It positively regulates PDPK1 kinase activity by dissociating it from the 14-3-3 protein YWHAQ, acting as a negative regulator. In the absence of TGF-beta, SMAD3 exists as a monomer, whereas in the presence of TGF-beta, it forms homooligomers or heterotrimers, contributing to the versatility of its functions. SMAD3 engages in a complex interaction network with various proteins, including but not limited to MAGI2/ARIP1, ACVR2A, ACVR1B, JUN, FOS, RAN, XPO4, NEDD9, ITCH/AIP4, NEDD9/HEF1, ZNF451, PPM1A, ZMIZ1, RNF111, RANBP3, EP300, TGFBR1, TGFB1I1, PRDM16, SNW1, ZFYVE9, HDAC1, TGIF2, SKOR1, SKOR2, DACH1, RBPMS, MECOM, WWTR1, SKI, MEN1, IL1F7, CSNK1G2, PDPK1, DAB2, USP15, PPP5C, LDLRAD4, PMEPA1, ZNF451, ZFHX3, ZNF8, STUB1, HSPA1A, HSPA1B, HSP90AA1, HSP90AB1, YAP1, CITED2, HGS, WWP1, TTRAP, FOXL2, PML, NEDD4L, ZC3H3, TGIF, CREBBP, ATF2, NEDD9, and more, highlighting its central role in diverse cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

N-6*His;N-Flag

Accession

P84022-1 (S2-S425)

Gene ID
Molecular Construction
N-term
6*His-Flag
SMAD3 (S2-S425)
Accession # P84022-1
C-term
Synonyms
Mothers against decapentaplegic homolog 3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; JV15-2; SMAD family member 3; SMAD 3; Smad3; hSMAD3; SMAD3; MADH3
AA Sequence

SSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Molecular Weight

50-60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 10% Glycerol, 2 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SMAD3 Protein, Human (Flag-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMAD3 Protein, Human (Flag-His)
Cat. No.:
HY-P71323
Quantity:
MCE Japan Authorized Agent: