SUMO3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
SUMO3, a ubiquitin-like protein, exhibits versatile functionality by being covalently attached to target lysines, either as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 does not seem to participate in protein degradation; instead, it potentially acts as an antagonist of ubiquitin in the degradation process. Its involvement spans various cellular processes, including nuclear transport, DNA replication and repair, mitosis, and signal transduction. The covalent attachment of SUMO3 to its substrates necessitates prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, with promotion facilitated by E3 ligases such as PIAS1-4, RANBP2, or CBX4. SUMO3 is implicated in the regulation of the sumoylation status of SETX and engages in interactions with various proteins, including BMAL1, USP25 (via its SIM domain), SAE2, and UBE2I. Notably, its interaction with USP25 leads to the sumoylation of USP25, inhibiting its ubiquitin hydrolyzing activity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P55854 (S2-G92)
-
Molecular Construction
-
N-term
-
SUMO3 (S2-G92)
Accession # P55854 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SUMO3; SMT3 Suppressor Of Mif Two 3 Homolog 1; Prev. SMT3H1; Small Ubiquitin-Related Modifier 2; SMT3A; Ubiquitin-Like Protein SMT3B; Small Ubiquitin-Related Modifier 3; Ubiquitin-Like Protein SMT3A; SUMO-3; SMT3 Homolog 1; SMT3 Suppressor Of Mif Two 3 Ho
-
AA Sequence
SEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
-
Predicted Molecular Mass
11.1 kDa
-
Molecular Weight
Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 10% trehalose, 3% Dextran-70, 50 mM NaCl, 0.05% Tween 80, pH 3.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
