1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta & TβRs
  5. TGF beta 1/TGFB1 Protein, Mouse (HEK293)

TGF beta 1/TGFB1 Protein, Mouse (HEK293)

Cat. No.: HY-P7117
Handling Instructions

TGF beta 1 Protein, Mouse (HEK293) is a multifunctional cytokine that controls numerous biological processes including immunity, differentiation, tumor suppression, tumor metastasis, senescence, migration, wound healing, apoptosis, cell division, adipogenesis, and osteogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $290 Get quote
50 μg $790 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

TGF beta 1/TGFB1 Protein, Mouse (HEK293) Featured Recommendations:

Top Publications Citing Use of Products

TGF beta 1/TGFB1 Protein, Mouse (HEK293) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

HEK 293

Accession

P04202 (A279-S390)

Gene ID

21803

Synonyms
rMuTGF-beta 1/TGFB1; Transforming growth factor beta-1; TGF-β1; LAP
AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

Approximately 12.8 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 4 mM HCl.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

TGFβ1 regulates cell proliferation, growth, differentiation and cells movement. TGFβ1 also has immunomodulatory and profibrogenic effects. Lack of TGFβ1-dependent growth control may result in oncogenesis: papillary, follicular and anaplastic thyroid cancers, prostate, breast and uterine cervical cancer, oesophagus, gastric, colorectal and liver cancers, NSCLC, and malignant melanoma. Excessive TGFβ1 activity is an integral part of the fibrotic processes occurring in the response to injury[1]. TGFβ1 can induce renal fibrosis via activation of both canonical (Smad-based) and non-canonical (non-Smad-based) signalling pathways, which result in activation of myofibroblasts, excessive production of extracellular matrix (ECM) and inhibition of ECM degradation[2]. TGF-β1 induces anti-inflammatory regulatory T cells (Treg), and inflammatory T helper 17 (Th17) cells in combination with interleukin-6[3].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 1/TGFB1 Protein, Mouse (HEK293)
Cat. No.:
HY-P7117
Quantity:
MCE Japan Authorized Agent: