Copy Link Print Information

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)

71 Cited Publications
Customer Review

Based on 71 publication(s) in Google Scholar

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) is a recombinant protein (A279-S390) produced by HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Rat; Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) is a recombinant protein (A279-S390) produced by HEK293 cells[1][2].

Background

TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII[3].
The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases[4].
TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer[4].

In Vitro

TGFB1 (1-1 ng/ml, 6 min) induces phosphorylation of SMAD2 and SMAD3 in CLENDO cells[5].
TGFB1 (1 ng/mL) significantly reduced both basal and fetal-calf-serum-stimulated DNA synthesis, without reducing cell viability[5].
TGFB1 (1 ng/mL) decreases CLENDO cell migration and causes loss of VE-cadherin from cellular junctions[5].

In Vivo

TGF-β1 (1 ng/ μL, 2 μL, i.c.v.) significantly blocks the antidepressant effects of (R)-ketamine in CSDS susceptible mice[6].

Verified Bioactivity

1. Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells and the ED50 is 5-25 pg/mL.
2. Measured by its ability to inhibit cell proliferation of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is <0.8 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit cell proliferation of Mv.1.lu mink lung epithelial cells. The ED50 for this effect is 0.094 ng/mL, corresponding to a specific activity is 1.06×107 units/mg.

Technical Parameters

  • Species Rat; Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P04202/P17246 (A279-S390)

  • Gene ID
    21803  [NCBI]/59086
  • Molecular Construction
    • N-term
    • TGFB1 (A279-S390)
      Accession # P04202
    • C-term
  • Protein Length

    Full Length of TGFB1 Chain

  • Synonyms

    TGFB1; Transforming Growth Factor Beta1; Prev. TGFB; Camurati-Engelmann Disease; Prev. DPD1; Latency-Associated Peptide; TGFbeta; TGF-Beta-1; CED; TGF-Beta1; Transforming Growth Factor Beta-1 Proprotein; IBDIMDE; Prepro-Transforming Growth Factor Beta-1;

  • AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 13-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 4mM HCL, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991)10:1091-1101.

[2]. M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14(4):2352-60. [Content Brief]

[3]. Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991.

[4]. Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124(Pt 14):2501-10. [Content Brief]

[5]. Justin Rustenhoven, et al. TGF-beta1 regulates human brain pericyte inflammatory processes involved in neurovasculature function. Justin Rustenhoven. 2016 Feb 11;13:37. [Content Brief]

[6]. Kai Zhang, et al. Essential role of microglial transforming growth factor-β1 in antidepressant actions of (R)-ketamine and the novel antidepressant TGF-β1. Transl Psychiatry. 2020 Jan 27;10(1):32. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit cell proliferation of Mv.1.lu mink lung epithelial cells. The ED50 for this effect is 0.094 ng/mL, corresponding to a specific activity is 1.06×107 units/mg.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    Customer Validation
     SLC14A1 overexpression enhanced, while its knockdown diminished, the activity of the TGF-β pathway in CRC cells. Western blot analysis was performed to assess the expression of relevant proteins in cells with overexpressed or knocked down SLC14A1, post-stimulation with TGF-β1 (1 ng/mL, 10 min)

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    Customer Validation
     Quantitative PCR (qPCR) analysis demonstrates increased SLC14A1 mRNA in SW480 and HCT116 cells following treatment with TGF-β1 (1 ng/ml). Data are presented as mean ± SEM, and statistical significance was assessed using a 2-tailed, unpaired t-test (**P < 0.01, *P < 0.05).

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    Customer Validation
     Western blot analysis confirms elevated SLC14A1 protein levels post-TGF-β1 treatment (1 ng/ml).in SW480 and HCT116 cells.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Jan;11(1):e2305622. [Abstract]

    Customer Validation
     Immunofluorescence (IF) results and 3D surface plots of αSMA expression after HaCaT cells treated with TGF-β (1 ng/mL, 24 h)

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2023 Jan 19;14(1):40. [Abstract]

    Customer Validation
     PDGF-BB (20 ng/mL, 72 h), TGF-β1 (5 ng/mL, 72 h), and VEGFA (5 ng/mL, 72 h) upregulated the protein expression of collagen I, α-SMA, and NRP1 in primary HSCs.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Agric Food Chem. 2023 Dec 13;71(49):19475-19487. [Abstract]

    Customer Validation
     HSC-T6 cells were treated with aloin (5, 10, and 20 μM) for 48 h with or without TGF-β1 (5 ng/mL). Western blotting analysis of α-SMA and Col1a2 expression in HSC-T6 cells.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Theranostics. 2021 Jan 9;11(7):3244-3261. [Abstract]

    Customer Validation
     Primary normal mouse lung (myo)fibroblasts were stimulated with 2 ng/mL of TGF-β1 for 48 h. The expression of collagen I, α-smooth muscle actin (α-SMA), PTPN13, and NOX4 was measured by western blot.

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) Product Image
    1/16
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) Product Image

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    SLC14A1 overexpression enhanced, while its knockdown diminished, the activity of the TGF-β pathway in CRC cells. Western blot analysis was performed to assess the expression of relevant proteins in cells with overexpressed or knocked down SLC14A1, post-stimulation with TGF-β1 (1 ng/mL, 10 min)

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    Quantitative PCR (qPCR) analysis demonstrates increased SLC14A1 mRNA in SW480 and HCT116 cells following treatment with TGF-β1 (1 ng/ml). Data are presented as mean ± SEM, and statistical significance was assessed using a 2-tailed, unpaired t-test (**P < 0.01, *P < 0.05).

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208. [Abstract]

    Western blot analysis confirms elevated SLC14A1 protein levels post-TGF-β1 treatment (1 ng/ml).in SW480 and HCT116 cells.

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Jan;11(1):e2305622. [Abstract]

    Immunofluorescence (IF) results and 3D surface plots of αSMA expression after HaCaT cells treated with TGF-β (1 ng/mL, 24 h)

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2023 Jan 19;14(1):40. [Abstract]

    PDGF-BB (20 ng/mL, 72 h), TGF-β1 (5 ng/mL, 72 h), and VEGFA (5 ng/mL, 72 h) upregulated the protein expression of collagen I, α-SMA, and NRP1 in primary HSCs.

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: J Agric Food Chem. 2023 Dec 13;71(49):19475-19487. [Abstract]

    HSC-T6 cells were treated with aloin (5, 10, and 20 μM) for 48 h with or without TGF-β1 (5 ng/mL). Western blotting analysis of α-SMA and Col1a2 expression in HSC-T6 cells.

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MedChemExpress. Usage Cited in: Theranostics. 2021 Jan 9;11(7):3244-3261. [Abstract]

    Primary normal mouse lung (myo)fibroblasts were stimulated with 2 ng/mL of TGF-β1 for 48 h. The expression of collagen I, α-smooth muscle actin (α-SMA), PTPN13, and NOX4 was measured by western blot.