1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)

Cat. No.: HY-P7117
Handling Instructions Technical Support

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) is a recombinant protein (A279-S390) produced by HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
250 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) Featured Recommendations:

Top Publications Citing Use of Products

61 Publications Citing Use of MCE TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)

WB
IF
RT-PCR

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208.  [Abstract]

    SLC14A1 overexpression enhanced, while its knockdown diminished, the activity of the TGF-β pathway in CRC cells. Western blot analysis was performed to assess the expression of relevant proteins in cells with overexpressed or knocked down SLC14A1, post-stimulation with TGF-β1 (1 ng/mL, 10 min)

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208.  [Abstract]

    Quantitative PCR (qPCR) analysis demonstrates increased SLC14A1 mRNA in SW480 and HCT116 cells following treatment with TGF-β1 (1 ng/ml). Data are presented as mean ± SEM, and statistical significance was assessed using a 2-tailed, unpaired t-test (**P < 0.01, *P < 0.05).

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2024 Jul 27;43(1):208.  [Abstract]

    Western blot analysis confirms elevated SLC14A1 protein levels post-TGF-β1 treatment (1 ng/ml).in SW480 and HCT116 cells.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2024 Jan;11(1):e2305622.  [Abstract]

    Immunofluorescence (IF) results and 3D surface plots of αSMA expression after HaCaT cells treated with TGF-β (1 ng/mL, 24 h)

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: Cell Death Dis. 2023 Jan 19;14(1):40.  [Abstract]

    PDGF-BB (20 ng/mL, 72 h), TGF-β1 (5 ng/mL, 72 h), and VEGFA (5 ng/mL, 72 h) upregulated the protein expression of collagen I, α-SMA, and NRP1 in primary HSCs.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: J Agric Food Chem. 2023 Dec 13;71(49):19475-19487.  [Abstract]

    HSC-T6 cells were treated with aloin (5, 10, and 20 μM) for 48 h with or without TGF-β1 (5 ng/mL). Western blotting analysis of α-SMA and Col1a2 expression in HSC-T6 cells.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) purchased from MCE. Usage Cited in: Theranostics. 2021 Jan 9;11(7):3244-3261.  [Abstract]

    Primary normal mouse lung (myo)fibroblasts were stimulated with 2 ng/mL of TGF-β1 for 48 h. The expression of collagen I, α-smooth muscle actin (α-SMA), PTPN13, and NOX4 was measured by western blot.
    • Biological Activity

    • Technical Parameters

    • Properties

    • 제품 설명

    • References

    제품 설명

    TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) is a recombinant protein (A279-S390) produced by HEK293 cells[1][2].

    Background

    TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII[3].
    The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases[4].
    TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer[4].

    In Vitro

    TGFB1 (1-1 ng/ml, 6 min) induces phosphorylation of SMAD2 and SMAD3 in CLENDO cells[5].
    TGFB1 (1 ng/mL) significantly reduced both basal and fetal-calf-serum-stimulated DNA synthesis, without reducing cell viability[5].
    TGFB1 (1 ng/mL) decreases CLENDO cell migration and causes loss of VE-cadherin from cellular junctions[5].

    In Vivo

    TGF-β1 (1 ng/ μL, 2 μL, i.c.v.) significantly blocks the antidepressant effects of (R)-ketamine in CSDS susceptible mice[6].

    Biological Activity

    1. Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells and the ED50 is 5-25 pg/mL.
    2. Measured by its ability to inhibit cell proliferation of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is <0.8 ng/mL.

    • Measured by its ability to inhibit cell proliferation of Mv.1.lu mink lung epithelial cells. The ED50 for this effect is 0.094 ng/mL, corresponding to a specific activity is 1.06×107 units/mg.
    Species

    Rat; Mouse

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P04202/P17246 (A279-S390)

    Gene ID

    21803  [NCBI]/59086

    Molecular Construction
    N-term
    TGFB1 (A279-S390)
    Accession # P04202
    C-term
    Protein Length

    Full Length of Mature TGFB1

    Synonyms
    rMuTGF-beta 1/TGFB1; Transforming growth factor beta-1; TGF-β1; LAP
    AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

    Predicted Molecular Mass
    12.8 kDa
    분자량

    Approximately 13-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.22 μm filtered solution of 4mM HCL, pH 2.5.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    선적

    Room temperature in continental US; may vary elsewhere.

    각종 서류
    References

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    최근 본 상품:

    온라인 문의

    Your information is safe with us. * Required Fields.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)

     

    Requested Quantity *

    고객명 *

     

    호칭

    메일주소 *

     

    전화번호 *

    Department

     

    회사명 *

    City

    Country or Region *

         

    비고

    대량구매 문의

    Inquiry Information

    상품명:
    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
    Cat. No.:
    HY-P7117
    수량:
    MCE Japan Authorized Agent: