1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. TGF-beta Receptor TGF-β Receptor 1
  5. TGFBR1/ALK-5 Protein, Human (HEK293, His-Fc)

TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, His-Fc) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, His-Fc) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

The transmembrane serine/threonine kinase, TGFBR1 (ALK-5), collaborates with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, to form the dedicated receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. Serving as a signal transducer, TGFBR1 mediates the transmission of TGFB1, TGFB2, and TGFB3 signals from the cell surface to the cytoplasm, thereby orchestrating a diverse array of physiological and pathological processes. These include cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex, composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2, causing its dissociation from the receptor and interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR1 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, it induces TRAF6 autoubiquitination, leading to MAP3K7 ubiquitination and activation, triggering apoptosis. TGFBR1 also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway involving PARD6A phosphorylation and activation.

Biological Activity

1.This product does not contain protein kinase domain.
2.Human TGFB1 protein (HY-P7118) immobilized on CM5 Chip can bind Human TGF-beta RI with an affinity constant of 8.48 nM as determined in SPR assay.

  • Human TGFB1 protein (HY-P7118) immobilized on CM5 Chip can bind Human TGF-beta RI with an affinity constant of 8.48 nM as determined in SPR assay.
Species

Human

Source

HEK293

Tag

C-hFc;C-His

Accession

P36897-1 (L34-E125)

Gene ID
Molecular Construction
N-term
TGFBR1 (M1-E125)
Accession # P36897
hFc-His
C-term
Protein Length

Extracellular Domain

Synonyms
TGF-beta receptor type-1; ALK-5; SKR4; TbetaR-I; AAT5
AA Sequence

MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

Predicted Molecular Mass
38.1 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TGFBR1/ALK-5 Protein, Human (HEK293, His-Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFBR1/ALK-5 Protein, Human (HEK293, His-Fc)
Cat. No.:
HY-P74523
Quantity:
MCE Japan Authorized Agent: