TGFBR2/TGF-beta RII Protein, Rat (HEK293, Fc)

TGFBR2 is a transmembrane kinase that forms the TGF-β receptor complex with TGFBR1 and regulates various processes. Upon binding to cytokines, this complex activates TGFBR2, initiating SMAD-dependent signaling through phosphorylation of TGFBR1, SMAD2, and SMAD4. TGFBR2/TGF-beta RII Protein, Rat (HEK293, Fc) is the recombinant rat-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-hFc labeled tag.

TGFBR2, a transmembrane serine/threonine kinase, partners with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, to form the specific receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. This receptor complex plays a pivotal role in transducing signals from the cell surface to the cytoplasm, thereby regulating diverse physiological and pathological processes. These include inducing cell cycle arrest in epithelial and hematopoietic cells, controlling mesenchymal cell proliferation and differentiation, influencing wound healing, extracellular matrix production, immunosuppression, and participating in carcinogenesis. The assembly of the receptor complex, comprising two TGFBR1 and two TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the constitutive activation of TGFBR2 and subsequent phosphorylation and activation of TGFBR1. Activated TGFBR1 then phosphorylates SMAD2, which dissociates from the receptor and forms a complex with SMAD4. This SMAD2-SMAD4 complex translocates to the nucleus, modulating the transcription of TGF-beta-regulated genes, thereby initiating the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways.

1.This product does not contain protein kinase domain.
2.Measured by its ability to bind canine TGFB1-His in a functional ELISA.

Rat

HEK293

C-hFc

P38438 (I24-Q166)

81810  [NCBI]

Extracellular Domain

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.