1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIGIT Protein
  5. TIGIT Protein, Rat (122a.a, HEK293, Fc)

TIGIT is a kind of inhibitory immune checkpoint, which can exert immunosuppressive function by directly or indirectly inhibiting effector T cells and up-regulating Treg cells. TIGIT shows low affinity binding to NECTIN2 and NECTIN3. TIGIT Protein, Rat (122a.a, HEK293, Fc) is the recombinant rat-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Rat (122a.a, HEK293, Fc) is 122 a.a., with molecular weight of 48-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIGIT is a kind of inhibitory immune checkpoint, which can exert immunosuppressive function by directly or indirectly inhibiting effector T cells and up-regulating Treg cells. TIGIT shows low affinity binding to NECTIN2 and NECTIN3. TIGIT Protein, Rat (122a.a, HEK293, Fc) is the recombinant rat-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Rat (122a.a, HEK293, Fc) is 122 a.a., with molecular weight of 48-55 kDa.

Background

TIGIT is an inhibitory immune checkpoint. By binding with CD155 and other antibodies, Tigit can promote the depletion of NK cells and reduce the secretion of cytokines. It can also exert immunosuppressive function by directly or indirectly inhibiting effector T cells and up-regulating the role of Treg cells. TIGIT plays a synergistic inhibitory role with PD-1/PD-L1, TIM-3 and other co-inhibitory receptors. TIGIT protein plays a key role in immune regulation and binds to poliovirus receptor (PVR) with high affinity. This interaction results in increased IL10 secretion and decreased IL12B secretion, resulting in an immunosuppressive environment. TIGIT further plays an immunomodulatory role by inhibiting T cell activation and promoting the generation of mature immunomodulatory dendritic cells. TIGIT shows low affinity binding to NECTIN2 and NECTIN3[1][2][3].

Biological Activity

Immobilized Human Nectin-2 His at 5 μg/mL (100 μL/well) can bind Rat TIGIT Fc with a linear range of 0.039-5 μg/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

D3ZTQ2 (A17-A138)

Gene ID

363784

Molecular Construction
N-term
TIGIT (A17-A138)
Accession # D3ZTQ2
hFc
C-term
Protein Length

Partial

Synonyms
TIGIT; VSIG9; VSTM3
AA Sequence

AFLAAGATAGTMETKGNISAEEGGSVVLQCHFSSDTAEVTQVNWEQRDQLLAVYSVDLGWYVPSVFSDRVVPGPSLGLTFQSLTTNDTGEYFCTYHTYPDGIYKGRIFLKVQESSAHFQIAL

Predicted Molecular Mass
39.9 kDa
Molecular Weight

Approximately 48-55 kDa under reduced (R) conditions, 85-110 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TIGIT Protein, Rat (122a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TIGIT Protein, Rat (122a.a, HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Rat (122a.a, HEK293, Fc)
Cat. No.:
HY-P78615
Quantity:
MCE Japan Authorized Agent: