Copy Link Print Information

TIM-3/HAVCR2 Protein, Marmoset (HEK293, His)

Customer Review

Based on 1 Customer Validation

TIM-3/HAVCR2 Protein is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Marmoset
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TIM-3/HAVCR2 Protein is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response[1]. TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TIM-3/HAVCR2 Protein is a transmembrane protein of T lymphocytes (CD4+ and CD8+ T cells), other lymphocytes (like NK cells), myeloid cells (monocytes, macrophages, DC, mast cells), or various cells in different tumor types. TIM-3/HAVCR2 Protein is an immune checkpoint and together with other inhibitory receptors including programmed cell death protein 1 (PD-1) and lymphocyte activation gene 3 protein (LAG3) mediate the CD8+ T-cell exhaustion in terms of proliferation and secretion of cytokines such as TNF-alpha, IFN-gamma and IL-2[2][3].TIM-3/HAVCR2 Protein has also been shown as a CD4+ Th1-specific cell surface protein that regulates macrophage activation, regulates the production of cytokines and enhances the severity of experimental autoimmune encephalomyelitis in mice[1].

Technical Parameters

  • Species Marmoset
  • Source HEK293
  • Tag C-6*His
  • Accession

    F7I881 (E21-I190)

  • Gene ID
    100399869  [NCBI]
  • Molecular Construction
    • N-term
    • TIM-3 (E21-I190)
      Accession # F7I881
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HAVCR2; FLJ14428; Hepatitis A Virus Cellular Receptor 2; HAVcr-2; TIMD3; TIMD-3; TIM3; T-Cell Immunoglobulin And Mucin Domain 3; Tim-3; T Cell Immunoglobulin Mucin 3; CD366; Kidney Injury Molecule-3; T-Cell Immunoglobulin And Mucin Domain-Containing Prote

  • AA Sequence

    EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRI

  • Predicted Molecular Mass

    19.7 kDa

  • Molecular Weight

    Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) Product Image
    1/16
  • TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) Product Image