TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

TIM-3/HAVCR2 protein, a cell surface receptor, plays a pivotal role in modulating both innate and adaptive immune responses. Predominantly considered as having an inhibitory function, the reported stimulating functions suggest a nuanced influence based on cellular context and ligand specificity. It regulates macrophage activation and inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses, promoting immunological tolerance. In CD8+ cells, TIM-3 attenuates TCR-induced signaling by blocking NF-kappaB and NFAT promoter activities, leading to reduced IL-2 secretion. This inhibitory function is proposed to involve its association with LCK, impairing the phosphorylation of TCR subunits. Conversely, TIM-3 has been shown to activate TCR-induced signaling in T-cells, likely implicating ZAP70, LCP2, LCK, and FYN. The receptor for LGALS9, TIM-3's binding to LGALS9 is believed to suppress T-cell responses, leading to apoptosis of antigen-specific cells. Additionally, TIM-3 may recognize phosphatidylserine on apoptotic cells, mediating their phagocytosis, and positively regulates innate immune responses, particularly in dendritic cells. It also plays a role in suppressing nucleic acid-mediated innate immune responses in tumor-infiltrating dendritic cells and negatively regulates NK cell function in LPS-induced endotoxic shock. Interactions with various signaling molecules, including HMGB1, BAG6, PIK3R1, PIK3R2, FYN, and ILF3, further contribute to the intricate regulatory functions of TIM-3 in immune responses.

Immobilized Human TIM-3, His Tag at 0.2 μg/mL (100 μL/well) can bind Anti-TIM3 Antibody. The ED₅₀ of human TIM-3 protein is 1.333 ng/mL, corresponding to a specific activity is 7.5019×10⁵ units/mg.

• 
  Immobilized Human TIM-3, His Tag at 0.2 μg/mL (100 μL/well) can bind Anti-TIM3 Antibody. The ED₅₀ of human TIM-3 protein is 1.333 ng/mL, corresponding to a specific activity is 7.5019×10⁵ units/mg.

Mouse

HEK293

C-hFc

Q8VIM0-1 (R20-R191)

171285  [NCBI]

Extracellular Domain

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

50-80 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.