TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
Free Sample		Apply now
2 μg	$68	In-stock	Estimated Time of Arrival: December 31
10 μg	$170	In-stock	Estimated Time of Arrival: December 31
50 μg	$470	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote
250 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 μg/mL.
Species	Mouse
Source	HEK293
Tag	C-hFc
Accession	Q8VIM0 (R20-R191)
Gene ID	171285 [NCBI]
Synonyms	Havcr2; Tim3; Timd3; Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; TIMD-3; T-cell immunoglobulin mucin receptor 3; TIM-3; T-cell membrane protein 3; CD antigen CD366
AA Sequence	RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Molecular Weight	Approximately 50.0 kDa
Purity	Greater than 90% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm solution of 1xPBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US;may vary elsewhere.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (232 KB) Handling Instructions (2659 KB)

TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email address *

Phone number *

Organization name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.