1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIM-3
  5. TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc)

TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc)

Cat. No.: HY-P71995
COA Handling Instructions

Accession#Q8VIM0-1 TIM-3 (R20-R191);C-hFc

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $50 In-stock
10 μg $145 In-stock
50 μg $410 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Accession#Q8VIM0-1 TIM-3 (R20-R191);C-hFc

Background

TIM-3/HAVCR2 protein, a cell surface receptor, plays a pivotal role in modulating both innate and adaptive immune responses. Predominantly considered as having an inhibitory function, the reported stimulating functions suggest a nuanced influence based on cellular context and ligand specificity. It regulates macrophage activation and inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses, promoting immunological tolerance. In CD8+ cells, TIM-3 attenuates TCR-induced signaling by blocking NF-kappaB and NFAT promoter activities, leading to reduced IL-2 secretion. This inhibitory function is proposed to involve its association with LCK, impairing the phosphorylation of TCR subunits. Conversely, TIM-3 has been shown to activate TCR-induced signaling in T-cells, likely implicating ZAP70, LCP2, LCK, and FYN. The receptor for LGALS9, TIM-3's binding to LGALS9 is believed to suppress T-cell responses, leading to apoptosis of antigen-specific cells. Additionally, TIM-3 may recognize phosphatidylserine on apoptotic cells, mediating their phagocytosis, and positively regulates innate immune responses, particularly in dendritic cells. It also plays a role in suppressing nucleic acid-mediated innate immune responses in tumor-infiltrating dendritic cells and negatively regulates NK cell function in LPS-induced endotoxic shock. Interactions with various signaling molecules, including HMGB1, BAG6, PIK3R1, PIK3R2, FYN, and ILF3, further contribute to the intricate regulatory functions of TIM-3 in immune responses.

Biological Activity

The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8VIM0-1 (R20-R191)

Gene ID

171285  [NCBI]

Molecular Construction
N-term
C-term
Synonyms
Havcr2; Tim3; Timd3; Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; TIMD-3; T-cell immunoglobulin mucin receptor 3; TIM-3; T-cell membrane protein 3; CD antigen CD366
AA Sequence

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Molecular Weight

Approximately 50.0 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-3/HAVCR2 Protein, Mouse (HEK 293, hFc)
Cat. No.:
HY-P71995
Quantity:
MCE Japan Authorized Agent: