Copy Link Print Information

TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

TIM-4/TIMD-4 Protein is a versatile phosphatidylserine receptor that plays multiple roles in immune response. It is involved in the phagocytosis of apoptotic cells and regulates T-cell activation in a bimodal manner, inhibiting naive T-cell activation while promoting the proliferation of activated T-cells through AKT1 and ERK1/2 phosphorylation and subsequent signaling pathways. TIM-4/TIMD-4 also participates in efferocytosis, the process of removing apoptotic cells by phagocytes, by directly binding to phosphatidylserine on apoptotic cells. It additionally promotes autophagy by suppressing NLRP3 inflammasome activity via the activation of the LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism. In the context of microbial infection, TIM-4/TIMD-4 plays a positive role in the exosome-mediated trafficking of HIV-1 virus and its entry into immune cells.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    AAH08988.1 (E25-L315)

  • Gene ID
    91937  [NCBI]
  • Molecular Construction
    • N-term
    • TIM-4 (E25-L315)
      Accession # AAH08988.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    TIMD4; T-Cell Membrane Protein 4; T Cell Immunoglobulin And Mucin Domain Containing 4; TIMD-4; TIM4; TIM-4; T-Cell Immunoglobulin And Mucin Domain-Containing Protein 4; T-Cell Immunoglobulin And Mucin Domain Containing 4; T-Cell Immunoglobulin Mucin Recep

  • AA Sequence

    ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

  • Predicted Molecular Mass

    32.7 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) Product Image
    1/16
  • TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) Product Image