TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag. The total length of TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is 315 a.a., with molecular weight of ~32.7 kDa.

TIM-4/TIMD-4 Protein is a versatile phosphatidylserine receptor that plays multiple roles in immune response. It is involved in the phagocytosis of apoptotic cells and regulates T-cell activation in a bimodal manner, inhibiting naive T-cell activation while promoting the proliferation of activated T-cells through AKT1 and ERK1/2 phosphorylation and subsequent signaling pathways. TIM-4/TIMD-4 also participates in efferocytosis, the process of removing apoptotic cells by phagocytes, by directly binding to phosphatidylserine on apoptotic cells. It additionally promotes autophagy by suppressing NLRP3 inflammasome activity via the activation of the LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism. In the context of microbial infection, TIM-4/TIMD-4 plays a positive role in the exosome-mediated trafficking of HIV-1 virus and its entry into immune cells.

Human

HEK293

C-His

Q96H15 (M1-L315)

91937  [NCBI]

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

Approximately 32.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.