1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. GITRL/AITRL
  6. AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi)

AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78791
Handling Instructions Technical Support

AITRL/TNFSF18 protein binds to TNFRSF18/AITR/GITR and regulates T cell responses. AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived AITRL/TNFSF18 protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag. The total length of AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 128 a.a., with molecular weight of 45-53 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AITRL/TNFSF18 protein binds to TNFRSF18/AITR/GITR and regulates T cell responses. AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived AITRL/TNFSF18 protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag. The total length of AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 128 a.a., with molecular weight of 45-53 kDa.

Background

AITRL/TNFSF18 protein, a cytokine, binds to TNFRSF18/AITR/GITR, playing a pivotal role in the regulation of T-cell responses. Functioning as a costimulator, it effectively lowers the threshold for T-cell activation and proliferation, contributing to the modulation of immune processes. AITRL/TNFSF18 is particularly significant for interactions between activated T-lymphocytes and endothelial cells, mediating the activation of NF-kappa-B and triggering increased phosphorylation of STAT1. Furthermore, it up-regulates the expression of adhesion molecules VCAM1 and ICAM1, thereby promoting leukocyte adhesion to endothelial cells. Additionally, AITRL/TNFSF18 is involved in the regulation of monocyte migration from the splenic reservoir to sites of inflammation. Existing as both a homodimer and homotrimer, AITRL/TNFSF18 showcases its versatile structural arrangements, highlighting its ability to engage in distinct molecular configurations for effective immune regulation.

Biological Activity

Immobilized Human GITR Fc at 2 μg/mL (100 μL/well) can bind Biotinylated Human GITR Ligand Avi-Fc with a linear range of 4-63 ng/mL.

Species

Human

Source

HEK293

Tag

N-hFc;N-Avi

Accession

Q9UNG2 (Q50-S177)

Gene ID
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
TNFSF18; AITRL; TL6; hGITRL; GITR Ligand
AA Sequence

QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Predicted Molecular Mass
43.5 kDa
Molecular Weight

Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78791
Quantity:
MCE Japan Authorized Agent: