AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi)

AITRL/TNFSF18 protein binds to TNFRSF18/AITR/GITR and regulates T cell responses. AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived AITRL/TNFSF18 protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag. The total length of AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 128 a.a., with molecular weight of 45-53 kDa.

AITRL/TNFSF18 protein, a cytokine, binds to TNFRSF18/AITR/GITR, playing a pivotal role in the regulation of T-cell responses. Functioning as a costimulator, it effectively lowers the threshold for T-cell activation and proliferation, contributing to the modulation of immune processes. AITRL/TNFSF18 is particularly significant for interactions between activated T-lymphocytes and endothelial cells, mediating the activation of NF-kappa-B and triggering increased phosphorylation of STAT1. Furthermore, it up-regulates the expression of adhesion molecules VCAM1 and ICAM1, thereby promoting leukocyte adhesion to endothelial cells. Additionally, AITRL/TNFSF18 is involved in the regulation of monocyte migration from the splenic reservoir to sites of inflammation. Existing as both a homodimer and homotrimer, AITRL/TNFSF18 showcases its versatile structural arrangements, highlighting its ability to engage in distinct molecular configurations for effective immune regulation.

Immobilized Human GITR Fc at 2 μg/mL (100 μL/well) can bind Biotinylated Human GITR Ligand Avi-Fc with a linear range of 4-63 ng/mL.

Human

HEK293

N-hFc;N-Avi

Q9UNG2 (Q50-S177)

8995  [NCBI]

Extracellular Domain

Biotin

QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.