Copy Link Print Information

UCHL3 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for UCHL3 Protein, Human (His)
  • UCHL3 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

Background

UCHL3 protein, a deubiquitinating enzyme (DUB), plays a crucial role in controlling cellular ubiquitin levels by processing ubiquitin precursors and hydrolyzing ubiquitinated proteins. As a thiol protease, UCHL3 exhibits a 10-fold preference for Arg and Lys at position P3'', with a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, influencing apical membrane recycling. Additionally, it indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, promoting insulin signaling and insulin-induced adipogenesis. UCHL3's involvement extends to stress-response in retinal, skeletal muscle, and germ cells, contributing to their maintenance. Notably, it can hydrolyze UBB(+1), a mutated form of ubiquitin associated with neurodegenerative disorders, which is not effectively degraded by the proteasome. This multifaceted enzyme may also play a role in working memory.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P15374 (M1-A230)

  • Gene ID
    7347  [NCBI]
  • Molecular Construction
    • N-term
    • UCHL3 (M1-A230)
      Accession # P15374
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UCHL3; Ubiquitin C-Terminal Hydrolase L3; Ubiquitin Carboxyl-Terminal Esterase L3 (Ubiquitin Thiolesterase); Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3; Ubiquitin Thioesterase L3; Ubiquitin Thiolesterase; UCH-L3; Ubiquitin Carboxyl-Terminal Hydrolas

  • AA Sequence

    MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

  • Predicted Molecular Mass

    27.3 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 50% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • UCHL3 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for UCHL3 Protein, Human (His)
  • UCHL3 Protein, Human (His) Product Image