UCHL3 Protein, Human (His)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein's involvement in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag. The total length of UCHL3 Protein, Human (His) is 230 a.a., with molecular weight of ~25.0 kDa.

UCHL3 protein, a deubiquitinating enzyme (DUB), plays a crucial role in controlling cellular ubiquitin levels by processing ubiquitin precursors and hydrolyzing ubiquitinated proteins. As a thiol protease, UCHL3 exhibits a 10-fold preference for Arg and Lys at position P3'', with a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, influencing apical membrane recycling. Additionally, it indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, promoting insulin signaling and insulin-induced adipogenesis. UCHL3's involvement extends to stress-response in retinal, skeletal muscle, and germ cells, contributing to their maintenance. Notably, it can hydrolyze UBB(+1), a mutated form of ubiquitin associated with neurodegenerative disorders, which is not effectively degraded by the proteasome. This multifaceted enzyme may also play a role in working memory.

Human

E. coli

C-6*His

P15374 (M1-A230)

7347  [NCBI]

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Approximately 25.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 50% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.